KEGG   Erythrobacter flavus: CHH26_07995Help
Entry
CHH26_07995       CDS       T04986                                 

Definition
(GenBank) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
efv  Erythrobacter flavus
Brite
KEGG Orthology (KO) [BR:efv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHH26_07995
Enzymes [BR:efv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CHH26_07995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ASP30182
UniProt: A0A222EUR0
Position
1613544..1614362
Genome map
AA seq 272 aa AA seqDB search
MPKIALLQMTSGIDPDANTRTLVEAIGQAAEQGATMLFTPEMSGLLDRDRKRAAAKVTTE
ARSPVLAAVREAAQARNIWVSLGSLALDTGEGRWANRGFAIDGEGAIRARYDKIHMFDVD
LDSGESWRESNAYKAGGGAVSVPDTPLGRLGLTICYDIRFPALFDALGRERCDVIAIPAA
FTVPTGKAHWHVLQRARAIEASAFVVAAAQVGEHADGRRTYGHSLVVDPWGEVLLDMGGD
AAGLAFCDIDLARIAEVRAQVPSLANRRQIAN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagattgcgctgttgcaaatgacatcgggtatcgatcccgatgccaatacccga
acgctggtcgaggcgatcggacaggcggccgaacagggtgccacgatgctgttcacgccc
gagatgtcgggcttgctggatcgcgaccgcaagcgcgcggcagcgaaggtcacgaccgag
gcgcgttcccccgttctagccgcagtgcgcgaggctgcacaggcgcgcaatatctgggtc
tcgctcgggtcgctggcgctcgacacgggcgagggacgctgggcaaatcgtggctttgcg
atcgacggtgagggcgcgatccgtgcgcgctatgacaagattcacatgttcgatgtcgat
ctcgatagcggcgaaagctggcgcgaatcgaatgcctacaaggcagggggaggagcggtg
agcgtccccgatacgccgctgggcaggctggggttgacgatctgctacgacatccgcttt
ccggccctcttcgatgcgctgggccgcgaaaggtgcgatgtcatcgccattcccgctgcc
ttcacggtcccgaccggcaaggcgcactggcacgtgctgcaacgcgcgcgggcgatcgag
gcgagcgcgttcgtggtcgcggcagcgcaggtcggcgaacatgccgatggccgtcgcacc
tatggccacagcctcgtggtcgatccgtggggcgaggtcctgctggacatgggcggtgac
gctgccggcctcgcattctgcgatatcgacctggcgcgcattgcggaggtgcgtgcgcag
gttcccagccttgccaaccgtcgccaaatcgccaattag

DBGET integrated database retrieval system