KEGG   Erythrobacter flavus: CHH26_09875Help
Entry
CHH26_09875       CDS       T04986                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
efv  Erythrobacter flavus
Pathway
efv00071  Fatty acid degradation
efv00072  Synthesis and degradation of ketone bodies
efv00280  Valine, leucine and isoleucine degradation
efv00310  Lysine degradation
efv00362  Benzoate degradation
efv00380  Tryptophan metabolism
efv00620  Pyruvate metabolism
efv00630  Glyoxylate and dicarboxylate metabolism
efv00640  Propanoate metabolism
efv00650  Butanoate metabolism
efv00900  Terpenoid backbone biosynthesis
efv01100  Metabolic pathways
efv01110  Biosynthesis of secondary metabolites
efv01120  Microbial metabolism in diverse environments
efv01130  Biosynthesis of antibiotics
efv01200  Carbon metabolism
efv01212  Fatty acid metabolism
efv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:efv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHH26_09875
   00630 Glyoxylate and dicarboxylate metabolism
    CHH26_09875
   00640 Propanoate metabolism
    CHH26_09875
   00650 Butanoate metabolism
    CHH26_09875
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH26_09875
   00072 Synthesis and degradation of ketone bodies
    CHH26_09875
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHH26_09875
   00310 Lysine degradation
    CHH26_09875
   00380 Tryptophan metabolism
    CHH26_09875
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHH26_09875
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHH26_09875
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHH26_09875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efv04147]
    CHH26_09875
Enzymes [BR:efv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHH26_09875
Exosome [BR:efv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH26_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASP30497
UniProt: A0A222EV79
Position
2005569..2007074
Genome map
AA seq 501 aa AA seqDB search
MSQADSELTPVIAGVGQINDRPDHPGDGLDPVGLMTEALRRAESDAGAELLSNCDSLAVV
AQLAWPQLNPVDGKVAEALGIEPAHRMQTAMPNGDSPILLLHEAANRIGRGEARICAVTG
GEALRTAGQLAALKKRENGDKPNALRDASHRVRKGYAQSYGLVVPTDVYPLYENAGRAAY
GQTLEEGQAESGTIWAAMSQVAATSPGAWLRKPVGADEIITPGDSNRAIAFPYTKLQVAN
SSVNQGAGFIVTSLAEARRKGIAEDRLVFLGYGAAAHESDNFLARDRYDASPSLATSIER
TMELNGANSEELTHVELYSCFPCVPKMARRVLDWPLDKPTTVFGGLTFGGGPIGNYMSHA
VVAMVEKLRGTSDKGLLFANGGYATHNHTILLAGAPTGATFPQEFDYQAEADSRRGTVPE
LDKDYAGPAEIETYTVHYGRDGSARSGVVVAQTPAGARTLAAIPASDEAAIAFLTDGKCE
PVGTAGRIERDAEGLARWRLG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagcggattcggaactgacgcccgtcattgcaggcgtcggtcaaatcaacgac
cgacccgatcatccgggcgatggactggatccggtgggtcttatgacggaggcgttgcgc
cgtgccgagtccgacgcgggtgccgagctcctgtcgaattgcgattcactcgccgtggtc
gcgcaattggcatggccccagctcaatccggtggatgggaaggtcgccgaggcgctcggt
atcgagcccgcgcatcgcatgcagaccgcaatgcccaatggggacagtccgatcctgctg
ctgcacgaagcggccaatcgcatcggtcgcggagaagcccggatttgtgcggtgaccggg
ggcgaagccctgcgcaccgcgggccagcttgcggcgttgaagaagcgcgagaatggcgac
aaacccaacgcgctgcgcgatgcaagccaccgcgttcgcaaaggctatgcccaaagctac
gggctcgtcgtgccgacagatgtttatccgctctacgagaatgcagggagggccgcctac
ggccagacgctcgaggagggacaagccgaaagcggcacaatctgggccgcgatgagccaa
gtcgccgcgaccagcccgggcgcgtggctccgcaagccagtcggtgccgatgagataatc
acgccgggcgacagcaatcgcgcgatcgccttcccctacaccaagcttcaggtcgccaac
tcctcggtcaatcagggcgcaggcttcatcgtgacttcgcttgccgaagcgcggcgcaag
ggcatcgcggaggaccggctggtatttctgggctatggtgcggcagcgcacgaaagcgac
aatttcctcgcgcgtgatcgctatgacgcctcgcccagcctcgccacatcgatcgaacga
acgatggaactcaacggtgcgaacagcgaagaactaacgcatgtcgaactgtacagttgc
ttcccctgcgttcccaagatggctcgacgcgtgctcgactggccgctcgacaagccgacc
accgtattcggcgggcttaccttcggcggtggaccgatcggaaactacatgagccatgcg
gtggtcgcgatggtcgagaaactgcgcggtacatcggacaagggcctgttgttcgccaat
ggcggatatgccacccataatcacacgatcctgctggcgggcgcgcctaccggggcaacc
ttcccacaggagttcgactatcaggccgaagccgattcccgccgcggaaccgtgcccgaa
ctcgacaaggattacgccggccctgccgagatcgagacctatacggtccattatggacgt
gacggctctgcgcgatcgggcgtcgtcgttgcgcaaacgcccgcgggcgcgcggaccctg
gccgcaatccctgcgagcgacgaagccgcaattgccttcctgaccgatgggaagtgcgag
cccgtgggcaccgcggggaggatcgaacgcgacgcggaaggcttagcgcgttggcgtttg
ggctga

DBGET integrated database retrieval system