KEGG   Enterococcus gallinarum: AL523_14460Help
Entry
AL523_14460       CDS       T04148                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ega  Enterococcus gallinarum
Pathway
ega00561  Glycerolipid metabolism
ega00640  Propanoate metabolism
ega01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AL523_14460
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AL523_14460
Enzymes [BR:ega01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AL523_14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AMG50869
UniProt: A0A0X8PRE2
Position
complement(3091375..3092475)
Genome map
AA seq 366 aa AA seqDB search
MERIFASPSRYVQGKGVLKDGLSHIKDLGKKVLLLTDETVWKIAGEDLFENLKAADLGPV
KEIFGGEASANEIDRIVSKAKSESIEVIAALGGGKAIGTGKAVADELNIPIAVLPTIAST
DAPTSALSVIYTDEGRFEKYRFYNKNPELVLVDTAVIAKAPAKLLAAGIADALATYVEAR
AVARSHSKNMVGGVQPIAGMAIAEKCEEILFENALKAYQANKKQVVTEAFEQIVEANTLL
SGLGFESAGLAAAHAIHNGLTALEGDVHDLTHGEKVAYGTLTQLMLENADPDEIDQYIEL
YQALELPTTLAEMHLSDVSDAELMKVGKQATIEGETIHNMPFTVSAEDVVAAIKAVDAYV
TAYYPL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaatatttgcgagtccgtcacgatacgttcaaggaaaaggagtattgaaggat
ggtttatctcacattaaagatctaggaaagaaagtgctgcttttgaccgatgaaacagtt
tggaaaattgccggggaagatttatttgaaaatctcaaagcggctgatttaggtccggta
aaagaaatttttggtggagaagcttctgcaaatgaaatcgatcgtatcgtctctaaagcc
aaaagcgaatccattgaagtaattgctgcattaggtggcgggaaagccatcggtactggg
aaagctgttgcggatgaattaaacataccgattgctgttttgccaacgatcgcttctact
gatgcaccaacttcggcactttctgttatttatacagatgaaggtcgctttgaaaaatat
cgtttttacaacaaaaaccctgaacttgtcttagtggatacagccgttattgcgaaagcg
cctgccaaattacttgcagcgggtattgcggatgcactagcaacctatgtcgaagcacgc
gccgttgcccgaagccatagtaagaatatggtgggtggtgttcaaccaattgccggcatg
gcaatcgctgaaaaatgcgaagagattctttttgagaatgcactgaaagcctatcaagca
aataaaaaacaagtcgttaccgaagcttttgaacaaatcgtggaagccaacactctgtta
agtggtttaggctttgaaagtgctggtttggcagcagctcatgcgatccataatggcttg
acagcccttgaaggagacgtccatgatttgactcatggggagaaagttgcttacgggaca
cttacacaattgatgctggaaaacgcggatcctgatgaaattgaccaatatattgagttg
tatcaggcgttggaattaccaacgacattagctgaaatgcatctttctgatgttagcgat
gcagagcttatgaaagtcggtaaacaagcaaccatcgaaggggagacgattcacaatatg
ccgttcacggtatccgcagaagatgttgtagccgcgatcaaagccgtggatgcctatgtg
actgcttattatcctctttaa

DBGET integrated database retrieval system