KEGG   Erwinia gerundensis: EM595_0314Help
Entry
EM595_0314        CDS       T04258                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ege  Erwinia gerundensis
Pathway
ege00010  Glycolysis / Gluconeogenesis
ege00020  Citrate cycle (TCA cycle)
ege00620  Pyruvate metabolism
ege01100  Metabolic pathways
ege01110  Biosynthesis of secondary metabolites
ege01120  Microbial metabolism in diverse environments
ege01130  Biosynthesis of antibiotics
ege01200  Carbon metabolism
Module
ege_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ege00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EM595_0314 (pckA)
   00020 Citrate cycle (TCA cycle)
    EM595_0314 (pckA)
   00620 Pyruvate metabolism
    EM595_0314 (pckA)
Enzymes [BR:ege01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EM595_0314 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: CUU22551
UniProt: A0A0U5L225
Position
1:complement(367848..369467)
Genome map
AA seq 539 aa AA seqDB search
MRVNGLTSPDLLALGITDTAEIVHNPDYDTLFQEETRPGLQGYERGILTQSGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWNDQGKGKNDNQPLSQETWQALKQQVTRQLSGKKLFVI
DAWCGANPDTRLSVRFITEVAWQAHFVKNMFIRPDDASLASFEPDFVVMNGAKCTNPDWQ
AQGLHSENFIAFNLTERMQLIGGTWYGGEMKKGLFAIMNYLLPLKGIASMHCSANVGKQG
DVALFFGLSGTGKTTLSTDPERQLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEQAEPEIY
HAIRRDALLENVVVRDDGSIDFDDDSKTENTRVSYPLYHIDNIVQPVSKAGHASKVIFLT
ADAFGVLPPVSRLDAEQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLMLHPTQY
AEVLVKRMQAAGTEAYLVNTGWNGSGKRISIKDTRAIINAILAGELSDAETQTLPIFNLQ
IPLALSGVDSEILDPRNSWSGEGAWEQKARDLAQRFITNFDKYTDTPAGAALVKAGPQL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaatggcctgacttcgcctgatcttcttgccctcggcatcactgatacggca
gagattgttcataatcctgattatgacaccctcttccaggaagaaacccgccccggcctg
caaggttacgagcgtggcatcctgacgcagtccggcgctatcgccgtcgataccggtatc
ttcaccgggcgctcacccaaagataaatacatcgtccgtgacgacaccacgcgcgatacc
ctgtggtggaacgatcagggcaagggtaaaaacgataaccaaccgctctcgcaagagaca
tggcaggcgctgaagcagcaggtgacgcgtcagctttccggtaaaaagctgttcgtgatt
gatgcctggtgcggcgccaaccccgatacacggctcagcgtacgcttcattactgaggtc
gcctggcaggcgcacttcgtaaaaaatatgtttatccgtcctgatgatgccagcctggcc
agcttcgaacccgactttgtggtgatgaacggcgccaaatgcaccaatcctgactggcag
gcgcaggggctgcattccgagaactttatcgcctttaatctcactgaacgcatgcaactg
attggcggcacctggtacggcggcgagatgaaaaaagggctgttcgccatcatgaactat
ctgttgccgctgaagggcattgcgtctatgcactgctcggctaacgttggcaaacagggc
gatgtggcactgttcttcggcctctcgggcaccggcaaaaccacgctgtcgaccgatccg
gagcgccagctgattggcgatgatgaacatggctgggatgatgatggcgtcttcaacttt
gaaggcggctgttacgccaagacgattcgtttgtcagagcaggctgagcctgagatttat
cacgcgattcgccgcgatgcgctgttggaaaacgttgtggtacgcgacgatggcagcatc
gattttgacgatgacagcaagaccgagaacacccgcgtctcttacccgctgtatcacatc
gacaatatcgtgcagccggtttccaaagcgggtcacgccagcaaggtcattttcctgacc
gctgacgcctttggcgtgctgccgccggtttcacgactggatgctgagcagacgcaatac
cattttctttccggcttcaccgccaagctggcgggcactgaacgcggcatcaccgaaccc
acgcccaccttttctgcctgcttcggcgcggcgtttttgatgctgcatccaacgcaatat
gcggaagtgctggtgaagagaatgcaggctgcgggcaccgaagcttatttagtaaatacc
ggctggaacggcagcggcaaacgtatctccattaaggatacgcgcgccatcatcaatgcc
attctggcgggtgaattaagcgatgccgagacgcaaacgttaccgattttcaacctgcag
attccgctggcactgagcggcgtcgacagcgagattctcgatccgcgtaatagctggtca
ggtgaaggagcatgggaacagaaagcgcgcgatctggcccagcgttttatcactaacttt
gataaatataccgatacgccagccggtgcggcgttggtaaaagcgggaccacagctgtaa

DBGET integrated database retrieval system