KEGG   Erwinia gerundensis: EM595_2838Help
Entry
EM595_2838        CDS       T04258                                 

Gene name
rlmM
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ege  Erwinia gerundensis
Brite
KEGG Orthology (KO) [BR:ege00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ege03009]
    EM595_2838 (rlmM)
Enzymes [BR:ege01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EM595_2838 (rlmM)
Ribosome biogenesis [BR:ege03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EM595_2838 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: CUU25069
UniProt: A0A0U5EC96
Position
1:complement(3033416..3034516)
Genome map
AA seq 366 aa AA seqDB search
MNKVLLYCRSGFEKECAAEITAKAAERNVFGFARVKEQSGYVLFECYQQGEAEKLLRELP
FQSLIFARQMVVVGELLRDLPSEDRITPVTGMLTGAVEKGGDLRVEVPDTNEAKELLKFC
RKFTVPLRASLRANKILLNYESAKRPVVHVFFIAPGTCYVGYSLPENNSPFFMGIPRLKF
PSDAPSRSTLKLEEAFHIFIPADEWDERLASGMYAVDLGACPGGWTYQLVKRSMMVHSVD
NGPMAQSLMDTGQVTHHKEDGFRYRPTRSNIYWLVCDMVEKPVRVANLMADWLVNGWCRE
AIFNLKLPMKKRYEEVSQNLQLIQERLQEKGINAQIHARQLYHDREEVTVHIRRIWSATP
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgttgttgtattgccgttccggctttgagaaagagtgcgcggctgagatt
acggccaaagccgcggagcggaacgtcttcggctttgctcgcgtgaaagagcagtccggt
tatgtgctgtttgaatgctatcagcagggtgaagcggagaagctgctgcgtgagctgccg
tttcagtcgttgatttttgcccgtcagatggtggtggtcggcgaactgctgcgcgatctg
cccagcgaggatcgcatcacgccggtgaccggcatgctgaccggagcggtggagaagggc
ggcgacctgcgcgtcgaggtgcccgataccaacgaagccaaagagctgctgaagttctgc
cgcaaatttaccgtgccgctgcgcgcgagcctgcgtgccaacaaaatcctgctcaactat
gagagcgcgaaacggccggtggtgcatgtgttctttatcgcaccgggcacctgttacgtc
ggctattcgctgccggaaaacaattcgccgttctttatgggcattccacgcctgaagttt
ccgtccgatgcgccgagccgttcaacgttaaagctggaagaggcatttcatattttcatt
cccgccgacgagtgggatgagcgtctggcgagcggcatgtatgctgtggatctcggtgcc
tgccccggcggctggacctatcagctggtgaaacgcagcatgatggtgcactcggtggat
aatggaccgatggcgcagagcctgatggacaccggccaggtgacccatcacaaagaagat
ggttttcgttatcgcccaacgcgcagcaacatttactggctggtttgcgacatggttgaa
aaaccggtgcgcgtggcgaacctgatggctgactggctggttaatggctggtgtcgtgag
gcgatcttcaaccttaaattaccgatgaaaaagcgctatgaagaggtgtcgcagaacctg
cagctgattcaggagcgtttgcaggaaaaaggcatcaacgcacaaattcatgcccgccag
ctttatcacgatcgtgaggaagtgacggtgcatatccgtcgcatctggagcgccacgccg
ggccgtcgcgacgagcgctaa

DBGET integrated database retrieval system