KEGG   Echinococcus granulosus: EGR_01849Help
Entry
EGR_01849         CDS       T05553                                 

Definition
(RefSeq) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
egl  Echinococcus granulosus
Pathway
egl00970  Aminoacyl-tRNA biosynthesis
egl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EGR_01849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:egl03029]
    EGR_01849
Enzymes [BR:egl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EGR_01849
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EGR_01849
Mitochondrial biogenesis [BR:egl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EGR_01849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 36337564
NCBI-ProteinID: XP_024354554
Position
Unknown
AA seq 512 aa AA seqDB search
MKVGTLERLRSALVRGKLDAGYLCRFLLNRIEIDKSASLEGRLASGLALPTTNSVISHST
ELAPLSSFGLLGGIPFLAKDNFCIKSRNATTCASKALHNYSPPFNASVVQALLDAGAICL
GKTNMDEFAMGSGSTDNTLHGPVVNPWSPSLPADPCIAGGSSGGSAAAVAAGLAPFALAS
DTGGSVRNPAALCGVVGLKPTYGLASRQGMIPLANIIDCPSIMATRVADVERVLSTWVQP
GSAARRGDATLATIQPPLLPDSPRIGIPKEYYAPGMAPEVVDVWDQVASWLADDFKLSVE
SVSLPHTPIATAVYSVLCSVEVASNMARYDGLRYGLRAEPTLEIREALTELNLDTSDGLA
AGSRRLGFGEEVRNRILAGNFFLLRGQRHLHLDAARRLWRLIKNDYMEVFTKVDFLLAPV
TLRPAPNLHEFCQMDSRSRIAREDPCTVGVNLAGLPAISIPIKLSAEKRLPIGLQLIGPP
WSEKDLLSLAGRIEEKADFPLLVDIPSLLDIK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggaactttagaacgcctacggagtgcattggtaagggggaaactggatgca
ggttatctctgtcgtttcctgctaaatagaatcgaaatagataagtccgctagcctggaa
ggccggttagcatctggtctcgctttgcctaccaccaattctgtcatcagtcattccaca
gagcttgcccccctttcctctttcggacttctgggtggtatacccttcttagccaaagat
aacttctgtattaagagtcgaaacgccaccacgtgtgcgtccaaggctctgcataactac
tcaccacctttcaacgcatcagttgttcaggccctgctagatgccggtgctatctgcttg
ggcaagaccaatatggatgaatttgcgatgggctcgggatcaactgataatacactgcac
gggcccgtggtgaatccctggtcaccctctttacctgccgatccttgcattgcgggaggt
agctccgggggtagcgcagcagcggtggctgctggtttggctcccttcgctcttgcttct
gacacgggcgggtcggtgcgaaatccggcggctctgtgcggtgttgtgggcctcaaaccc
acctatgggctggcatcgcgtcagggcatgatcccgcttgctaatatcatagattgtccc
tccattatggctactcgagttgcagacgttgaaagggtgctctccacttgggtccaaccg
gggagtgcggctagacgcggggacgctactctggccactatccaaccacctcttctgcct
gattcaccccgcatcggcatccccaaggagtactacgcgcccgggatggccccagaagtg
gtggatgtttgggatcaggtggcatcgtggctggcggatgattttaagctatctgtcgag
tctgtgagccttcctcacacacccattgcaactgcggtctactctgtcctgtgttcagta
gaggtagcatccaacatggcacgttacgacggccttcgatatggcctgcgggcggaaccc
accttggagatacgagaagcactgactgaactgaatttggacacctcggatggtctggcg
gcggggtctcggcggctaggctttggagaggaggtgcgtaaccgcatactggcggggaac
tttttcctacttcgtggacaaagacacctgcatctggatgctgctcgacgactctggcgt
cttattaaaaacgactacatggaggtcttcactaaagtggacttcctgttagctccagtg
actctacgtccagcgcccaatctgcatgagttttgccaaatggacagtcgttctcgaatc
gcccgggaggatccttgcacagttggagttaacttagcgggtctcccagcgatcagcatt
ccaattaaactgagtgctgagaagagactcccaataggactgcagctcatcggtcctccg
tggtctgaaaaggacctactttcacttgctggacgcattgaagaaaaagcggatttccct
ctacttgtggatataccatccctcttagacatcaagtag

DBGET integrated database retrieval system