KEGG   Echinococcus granulosus: EGR_04276Help
Entry
EGR_04276         CDS       T05553                                 

Definition
(RefSeq) Multiple inositol polyphosphate phosphatase
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
egl  Echinococcus granulosus
Pathway
egl00010  Glycolysis / Gluconeogenesis
egl00562  Inositol phosphate metabolism
egl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGR_04276
   00562 Inositol phosphate metabolism
    EGR_04276
Enzymes [BR:egl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     EGR_04276
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     EGR_04276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1
Motif
Other DBs
NCBI-GeneID: 36339991
NCBI-ProteinID: XP_024352033
Position
Unknown
AA seq 484 aa AA seqDB search
MSHIFVDIPGLIILSIGVIIYFFFSSSPYYDEHLIDGYSLTAFGSKTAYKNNGLKSVLPS
LLNRRRFVHVNALIRHGTRSPDSKFSKKVEKIRARLLKANCSLPDVDFSVKSCGKGDKVL
LSSGVKEIEDLGRRLRAIVPNEFRHASNMLVISSETERTIDSAKAFLSTYTDDNVTITED
FRRIRFFADCNNYISAVRSSEIARKEFYKFRDGKEMQRVLQEVVSDHGLEDLQLTTTDIE
NLYKVAAYEVAAMEEGSPLPGWVQLFRPEHLYVLEYLHDLKQYWTKGNAFPLSYEQVCPL
WGAIMEDMVKAATHDRDMVIAKRDGYDVSKLEKKSSHRSVFWFGHAETLLPLVTKLNLFN
ESVSSEFGGGEHLTAAGFQSRLRRLQLEELPVPNLFRSSHIIPFAGNIAFFLFYCPNLNE
EPSLNDYCLEVRLNEQVVEIIPQADGLPRPLRLPQVLAHFESCLPSAYNKTALCDRPLSS
PPSA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatatttttgttgacattcctggactaattatcttatccattggagtaataatt
tacttctttttctcgtcttcaccatactacgacgaacatctcattgatggctacagcctc
actgcatttggatcaaaaactgcatacaaaaataacggtcttaaatctgtacttccgtct
ctactcaaccgcaggcgtttcgttcatgtaaacgctctcatccgtcatgggacgcgttct
cctgatagcaaattctcgaagaaggtggaaaaaatacgagctagacttctaaaagccaat
tgtagtctcccagacgtggacttttctgtaaagtcatgtggaaaaggcgacaaggttctg
ttatcatctggagttaaggagatcgaagatcttggtcgtcgtctgcgtgcgatcgttccc
aatgaatttcggcacgcgtccaacatgcttgtaatttccagtgaaaccgagcgtactatt
gacagtgcgaaggcttttctttccacgtacacagatgacaatgtaaccatcacagaggac
tttagaaggattcgattctttgctgactgcaacaattatatctcagctgttcgatcgagc
gagattgcgagaaaagagttttacaagtttcgggatggcaaagagatgcagcgggtactg
caagaggtggtcagtgaccacggcttggaggaccttcaactaacaacaacggatatcgaa
aacttatataaagtagccgcttatgaagtcgccgctatggaagagggctcgccactcccc
ggatgggttcagctctttagaccggaacatctatatgttttggagtatcttcatgaccta
aaacagtactggacgaaaggaaatgcattcccactgagctatgagcaggtctgccctctc
tggggtgccattatggaggacatggtgaaggctgccacacacgaccgagacatggtcatc
gctaaacgagacggatacgatgtgagtaagctggagaagaagtcctcccaccgcagtgtc
ttttggttcggtcatgcggaaaccctgctgccactagtgacgaagttgaatctcttcaac
gagtccgtctcctcggagttcggtggcggggagcacttgaccgccgcgggcttccagtcg
cgtttgagacgacttcaactggaggagctgccagtgccgaatctcttccgctcctcgcat
atcattccttttgctggaaacatagccttcttcctcttctactgtcccaatcttaatgag
gagccctcgttgaacgactactgtctggaagtgcgactgaacgagcaagtagtggagata
ataccccaggcggatggattgccacgacctctgcggctaccccaagtgctggcgcatttc
gagagttgtctgccctcggcgtacaacaaaacagccctttgtgatcgacctctcagctct
ccgccttcggcgtga

DBGET integrated database retrieval system