KEGG   Echinococcus granulosus: EGR_04843Help
Entry
EGR_04843         CDS       T05553                                 

Definition
(RefSeq) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
egl  Echinococcus granulosus
Pathway
egl00450  Selenocompound metabolism
egl00970  Aminoacyl-tRNA biosynthesis
egl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EGR_04843
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EGR_04843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:egl01007]
    EGR_04843
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:egl03016]
    EGR_04843
Enzymes [BR:egl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EGR_04843
Amino acid related enzymes [BR:egl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EGR_04843
Transfer RNA biogenesis [BR:egl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EGR_04843
 Prokaryotic type
   Other AARSs
    EGR_04843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 36340558
NCBI-ProteinID: XP_024351481
Position
Unknown
AA seq 610 aa AA seqDB search
MRPRPAFITTPIFYPNAKPHLGHAYTLCIADAWSRFFAMRQHPSLQAFPPRRVFLRPPPA
RTSFLCTGVDEHGSKVRRSHSSHFRLLPKGSLRPYIIDFQGRLSVPYKSTSFQDLCENLN
ISTGAFIRTTSEAHKNTVCEAWRYLERSGYLYWNTFAGWYSISDETFYADWEVTDSPSSS
GVKVAKATHSVVNWVEEKTCRFRLSSFKDQLHIWLDSGVLPDKSQEHARLLALTHSSLDL
LEDPSISRPSSRVSWGIPVPDRPDQTIYVWFDALMSYLTAGKVSLNPTENKDAIWPPECQ
FIGKDILRFHAILWPAILLALGLPLPKKIIPHAHILVEGTKMSKSLSNVVSPVDMLKYFS
AAFAAASPTRLSDEEVRATAVDCLRYCLVRSACLNEDTTFSLPLATETVNTELVNWVGNL
LSRITSRKIISAQTVPMLDLVEAQAFMSDALLHRNLNLELETKNSLFMKQFVIFMLVLQT
RYTRFAVEQFSIFSLRCLPDTFDTLWWERLQPHHSVDALMKVVRKTNAFVDRHQPWASVA
VDDVMAKTVVGVTLEALRLIGCLLAPLTPSLSDRLLRRLGIRPDALRCSSWHLDLDDQSL
HRPLVPRIKV
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctcgacctgcttttattacgactccaatattttaccccaatgcgaagcctcat
ctcggtcatgcctacaccctctgtatagccgacgcgtggtcacgcttctttgccatgcga
caacatcctagtcttcaagccttcccccctcgacgtgttttcctgagaccaccgcctgca
cgaaccagcttcctctgcaccggtgtcgacgaacatggcagcaaagtgcgtcgctcgcac
agcagccactttcggctgctccccaaaggatctctgcgaccgtatatcattgactttcaa
ggcaggctcagcgttccttataaaagtacttcatttcaggacctctgtgagaacttgaac
atctctacgggtgccttcattcgaaccaccagtgaggcgcacaaaaacacggtttgcgaa
gcttggcgatatctggaacgatcaggctacctctactggaacacttttgctggatggtac
tcgattagtgacgagactttctacgccgattgggaggtcacagactccccttcctccagt
ggggtcaaggttgcaaaagctacacatagcgtggttaactgggtggaggagaagacctgt
cgatttcgtctctcatcttttaaggatcaacttcacatttggctggactcgggagtcctc
cctgacaaatcgcaagaacatgctcgactactagcgctgactcactccagtctcgatctt
ctcgaagatccctctatctcgcgccccagctcaagagtgtcctggggcattcccgttccc
gacagacccgaccaaacaatctacgtttggttcgatgctttgatgagctacctaacggcg
ggaaaggtttcgttgaaccccacagagaataaggatgcgatatggccaccggaatgtcag
tttattggcaaggatatcctgcgtttccatgccatactttggccagcgattttgctagca
ttgggactcccattgcccaagaagatcatcccacatgcacatattctggtggagggtaca
aagatgtccaagagcctaagcaacgtggtgagtccagtagacatgttgaagtacttttcc
gcggcttttgctgccgcctctcccactcgtctcagtgacgaagaggtgcgcgcaacggct
gttgactgccttcgctactgcctcgtgcgcagcgcctgtctcaacgaggacactaccttc
agcctccccctggccaccgagactgtcaacacagaacttgtcaactgggtgggaaatctg
ctctctagaatcacttcgaggaagatcatttcagctcaaaccgtgccgatgttagatcta
gtggaggcgcaggccttcatgtctgatgctctgcttcatcggaatcttaacttggaattg
gagacgaagaactcacttttcatgaaacaatttgtaatcttcatgcttgttttgcaaact
cggtacacgcggtttgcagtggagcagttctctattttcagcctcagatgtctccccgat
acctttgatacactgtggtgggagcgcctgcaaccacaccactcagtggacgcgttgatg
aaggtggtacgaaaaactaatgcctttgtcgatcgccatcagccctgggcgagtgttgct
gttgacgacgtgatggcaaaaacagtcgtcggggtcaccctagaggcccttcgattaatt
ggttgtcttcttgctccccttaccccttccttatccgaccgactgctgcgccgcctcgga
atccggccggacgcgttgaggtgctcctcttggcatttggacttggatgaccaatccctt
caccgaccccttgtgcctcgaattaaagtgtga

DBGET integrated database retrieval system