KEGG   Echinococcus granulosus: EGR_05876Help
Entry
EGR_05876         CDS       T05553                                 

Definition
(RefSeq) Dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
egl  Echinococcus granulosus
Brite
KEGG Orthology (KO) [BR:egl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egl04131]
    EGR_05876
Membrane trafficking [BR:egl04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    EGR_05876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 Arteri_Gl
Motif
Other DBs
NCBI-GeneID: 36341591
NCBI-ProteinID: XP_024350471
Position
Unknown
AA seq 2089 aa AA seqDB search
MADCSGLLCSAKYIPHYRLAPQGVDWPGCVYDENITRRPLFLLLRSDELSPRVETASTSL
FIVVYLFDAILDCRLSEAFNLGPEITGVFRVTDRWHELSKILLANEDHRENEDAATSLYK
EVGSYFRGVYLIIESIGTSALPNVKADYPPEGDCLQTPFAWNAIDLSTAVTQMCQKTLRD
PRRRHFSASERCYSVDHREGQSQRTTEAFRRPRLLSDANDSLKQPPRSRTVSNDRRFSVN
AFESSPSDLQVREVISKESDLQSLEESSPLWRLNTDELEDLPKFVEFNLQLTTRSFIKKD
LTTGSHSSEIRRTVMEVFKLQSSACNMSPWVHDIPTRVGHGHPLRRLKTFSGQMKVSMTG
KVVSACGLSRHLRSANFCSTEGEILLTRGYSETRLQEVMEFPTIGRVFPFNFSRNLLYIY
LQSVTFGMLKSVSKNIEIVIQLWCSDASGRHTIPAFHNLGAQNVLKTEARTHVILKNRSP
EFTDEIKVILPKELNSNHYLLFTFVHVDLSPSRDTSNSVLGYSWLPILISGRIFSGEEKL
YLTHDHPTPEMAQTIPRHVEALAKDDMEAGKTHFLNKTSFHLRVVPLSSLYQDDDFVASV
IRECNFANFTETSESLSKQDLFLAQSGSDSLSSPPPLLLHLQKAKLNQLVLHLVPIMDGL
LQTLGACLVQNNVKASQNLLTLLAFYIHRISKGLSDWEEQFTGRNRFICAYLSGIGRCSI
EHVLPYLLSGYPMMGLAWIDDVFEYLHRSNENLTKKLHEELLQCLIGQIATNTPFSRNFY
EETLWFFLELLVRTLIVECKISDESASQLFVENLDLLTREVTKSITNRLMQDDKEETFDS
TCLLNRAFAFFLQDLLICLNATHVFRFTSAYMQAINSFIEELLAPSSWNSEDEEAASSRD
KKVRNLQLLKLEMLQILTAAPDYLALSLPDQSLLPDTVHSINQVAYFTTFEQEDEILTDP
TYQRLHFLPAMLLGEIRTCLLHSEPALQENALTTLWYLMKSHESQSCTFRAGRESSNLWD
AAALYIPLLDIACDNASAMYVSWVGALKKQERVLREVAKVSVLLDAQRSSNDGASKRSGW
ILSSMTAKERVRWMGRRISLTPDRRGSVEHRSSSAPSLPSQQEYTTFPSPSKTWIHAVLS
SAPFSLPSETTHVFSDCVTRLLLLETLWILQYTHRQVLLQWLVTRGVEKAQNLVELLILA
LNYFEYPGGNEFLTESTDEDSKVVQKLGESPILQLKRLDNLGCQTTDTLPVACREETKLL
YLFVTSVVCKTLDLLINAFDHPLSASDVTGEESDNLIISSRLICSIARAYIFGLSMHHCS
KTFQLLCCGMSELISKFPQYFLDEASVTHFVLCRVLLPHCASPLKKIRKIANAAAFHLLQ
QCHQVCDHLYPVNGQMALALHSLLAPNDLTLDTSSSPSWFARRLGVVTECLSYLTEASTN
LYWHHLLSHLIYDRRIHGGQEGDPLFPTLAPPHIHFLLARAHLSACFRALKEYAKADTRE
GGDLGRNKGSGGVSFNGLRFAMTFANTQAPDAGFQAQLNASVDILHDIFTCLLHFNDLQR
RYTGSQIVEKDDRISVVELLVDLASVCRLLPELRQYWLLRLAEVHLFFKQPAEAAQALLH
TLAIDVEQMVSRKSSPLFTVLSEGVDSMARQLGSPNLLEESALELAVGLPASTPLPITAE
RSLQKTSANVFVKRFYELIERIAKCFHAADQSEQIPSLCYWILPILYSTREQECLRQVYE
LIRTSHSAIYEPARTNRLFNTYFRVGFYGPLFGDQNGKEFIYKEAPLTKLAEITARLQEF
YSHQLGGKPVEIIKSSSRVFAADLDEAIAYLQITYVEPHFEEFELRKRRLECERNYGIKR
FVMVTPFTQAGFAHGSISEQFKRKVILTTSRCFPYLNLRLPVIGHEELVLSPIEVAIEDV
ATRNQQLALAIHTDPPDAKFLQMVLQDETALFQGCVSTTVNQGPLEVAVAFLNKRGSPSS
SASQENPVITVSESDDEQQNELRLCLKEFLRKSQEAVRMNRQLIGQDQEEYQRELERNFV
QIKLQMEPFLKPPISFRDLITVGSGEGYRDSPKAMPPNESTIGGAFSAR
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atggccgactgttctggattattgtgctcggctaaatacattcctcactatcgacttgca
ccccaaggagtggattggccaggatgtgtttatgacgagaatatcacccgacgaccttta
tttcttcttcttcgatccgatgaactttcccctagggtggagacggcttctacatctttg
ttcattgtggtctatctctttgacgctatcctagattgtcgactctctgaggcgttcaat
ttggggcctgaaataacgggtgtttttcgagtcaccgacagatggcatgagttaagcaaa
attttgcttgcaaatgaagatcatcgtgagaatgaggatgctgcaacttcactttacaag
gaagtgggatcctactttaggggtgtataccttattatagagtcaataggcacttcagcg
ttacctaacgtgaaagctgactatcctccagaaggtgactgcctccagactcccttcgcg
tggaatgccatagatctctccactgcagtgactcagatgtgtcagaaaaccctcagagat
cccagacgacggcactttagtgcctctgaaagatgctattctgtggaccatagagaaggt
caaagccagcggacgactgaagcatttcgacgaccacggctcctctccgacgcaaatgac
tcgctaaaacaacctccacgtagtcgaaccgtttccaacgatcgtcgcttctctgtcaat
gcatttgaaagtagcccaagcgatctacaagtccgcgaagtcattagcaaagaatccgat
ttacaatctttagaagaatcctcacctctgtggaggcttaacacggacgaactggaagat
ttgcctaaattcgtcgagtttaatctccaattgaccacacgaagttttattaaaaaggat
ttgaccaccggtagccactccagtgagatcaggcggacggtcatggaggtctttaaactc
cagtcctccgcctgcaatatgagcccttgggtacacgatatacccactcgggtggggcat
ggtcatcctctgcgtcgattgaaaacgttcagtggacaaatgaaggtttcaatgacggga
aaagtagtgtctgcttgtggactctcacgtcacctccggagcgccaacttctgctccact
gagggtgagattctccttactagaggctattcagaaacaaggcttcaggaggtgatggaa
ttccccaccattggacgtgtttttcctttcaatttttcaagaaatctcctctacatttat
ctacagagcgttactttcggaatgctcaaaagcgtttcaaagaacatcgaaattgttata
cagttgtggtgttcggatgccagtggaaggcatacaattccggcatttcacaatctcggt
gcccagaatgtgctaaaaactgaagctcgaactcatgttatcctgaaaaaccgatcacct
gaattcactgatgaaatcaaagtgattcttccgaaggagctcaattcgaaccactacttg
ctctttacttttgtccacgtcgacctttcaccttcacgtgacaccagcaattccgtcctt
ggttactcgtggcttccgattctcattagtggaagaatattttctggagaagagaagctt
tatctaacccatgatcatcctactcccgaaatggcccaaacaatacctaggcatgttgaa
gccttggcaaaggatgacatggaggccgggaaaacgcattttctcaacaagacgtcattt
cacctccgtgtggtgccactcagcagtttgtaccaagacgatgactttgtcgcctcagtg
ataagagaatgtaattttgcgaatttcacggaaacaagtgaatcactgagcaaacaggac
ctctttttggcccaatcgggatcggattctctatcctctcctccgccactgcttttgcat
ctccagaaggcaaaactgaaccagctagttttgcatttggtgccaatcatggatggactg
ctacagactctaggagcctgtctggtacaaaacaatgtaaaagcatcacaaaatttactc
accctgctggctttctacattcatcgtatatcaaagggtctctccgactgggaagagcaa
tttactggacgcaatcgctttatatgtgcatatttatcaggcatcggaaggtgctccatt
gagcatgttctaccatatcttctctccggatatccaatgatgggactggcttggatagat
gatgttttcgagtacctccacaggtctaatgagaatttgaccaagaagttgcatgaggaa
ttgcttcaatgcctcatcggtcagattgccaccaatactccgttttccaggaacttctat
gaggagacgttgtggttcttcttggaactgctggttcgaactctaatcgtggaatgcaaa
attagcgatgaatccgccagccaactttttgtggaaaatttggatctccttactcgggaa
gtcacgaaaagcatcaccaaccgcctaatgcaggacgacaaggaggaaacctttgatagc
acttgccttctgaatcgcgctttcgcattctttctgcaggaccttttaatctgtctcaat
gccactcatgtgtttcggtttacctcagcttacatgcaggcaatcaactcattcattgaa
gaattgctggcacccagctcttggaactcggaggatgaagaggcagcgtcatctcgagac
aagaaggttcgaaatctgcaattactgaaactagaaatgcttcaaatcctcacagccgca
ccagactatctggctctgagtctacccgaccaaagtctgttgcctgatactgtgcattca
ataaatcaggtcgcttactttaccacatttgagcaggaagatgaaattctcactgatcca
acctaccaaagactacactttttaccagcgatgctactgggggaaattcgcacctgcctc
cttcattcagaacccgcattgcaggagaacgccctgactaccctatggtacctcatgaaa
agtcacgagtcccagtcttgcacatttagagcagggcgagaatcctccaatctctgggat
gcggctgcgctttacatcccacttctagacatcgcttgcgacaatgcctctgccatgtat
gtcagttgggtcggtgccttgaagaagcaggaaagagtgctcagagaggtggcaaaggtc
tctgtacttttggatgctcagcggagctcaaacgatggcgcttcgaagcggtccgggtgg
attttatcttctatgactgctaaggaacgggttagatggatgggtcgtcgtatctcgtta
actccggaccgtagaggatcagtggaacatcgttcatctagtgcaccgtcacttccatca
caacaagagtacaccactttccctagcccaagtaaaacgtggatccacgctgtcctctct
tcagctcccttctcactgcccagcgagacgactcacgtattcagtgactgtgtcacgaga
ctcctcctcttagagacgctttggatcctccaatacactcatcgacaggtccttctacag
tggctcgtcactaggggtgttgaaaaggcgcagaatcttgttgagctgctcattcttgct
ctcaactactttgagtatccgggtgggaatgagtttttgaccgagtcaacggacgaagac
tccaaagtcgttcagaagctcggggagtcgcccattctccagttgaagagattagacaat
ctcgggtgtcaaactactgatacactaccagtcgcgtgtcgtgaggagacaaaacttctc
tacctatttgtgacctcggtcgtgtgtaaaactttagatcttctcattaatgcctttgat
catcccctttcagctagtgatgtgacaggggaggagagtgacaacctgatcatatcttcc
cgcctcatttgcagtattgctagagcatacatctttggtctgagcatgcaccactgttcc
aaaacatttcagcttctttgctgtggcatgtccgaattgatctcaaagttcccacagtac
ttcctggacgaggcgtcggttacacacttcgtgctttgtcgggtgctactacctcattgt
gcctctccgctgaaaaaaattaggaagattgcaaatgctgctgcatttcacctccttcaa
cagtgccaccaagtttgcgatcacctgtatcctgtgaatggccaaatggccctggctcta
cactccctcctagcacccaacgatctcactcttgacacatcatcctccccctcctggttc
gcccgacgcctaggggtcgtgactgagtgtctctcctacctcaccgaggctagcactaac
ctctactggcaccatctcctctcccacctcatctacgaccgcaggattcatggtggtcag
gagggtgacccgctgtttcccacactcgctccccctcatattcacttccttttggcaaga
gcacatctttcggcttgctttcgggcgctcaaagaatacgctaaggcggatacaagggaa
ggaggtgatttagggagaaataaaggtagtggaggtgtgtcattcaacggactacgtttt
gcaatgacgtttgcaaatacccaagcgcctgatgctggatttcaggctcaacttaatgca
tctgtggatattttgcatgatatattcacatgcctccttcatttcaacgatctccaaaga
cgctataccggctcccagatcgttgaaaaggacgaccgaatttctgtggtcgagttgctc
gttgatctggcatctgtatgtcgtctgcttcctgaactgcggcagtactggcttttgcgt
cttgcagaggtccacttatttttcaaacagccagcagaagcagcccaagccctgcttcac
acccttgccatcgatgtggaacagatggtgagccggaaaagctcccccctcttcaccgtc
ctaagcgaaggcgttgattccatggcgcgtcaattgggatcgccaaacctcctagaggag
tcggctctagaactggccgttggacttccagcctccactcctctcccaatcacagctgaa
cgctccctgcagaagacctctgcaaacgtatttgtgaagcgcttttacgagttgatcgaa
agaattgctaagtgcttccatgcggccgatcaatctgagcagattccatcactttgttac
tggattctaccgattttgtactcaactagggaacaagagtgtctccgtcaggtgtacgaa
cttattcggacctcgcatagtgccatatacgaacctgcccgaacaaatcgcctcttcaat
acatactttcgagttggattttacggccctctgtttggtgaccagaatggcaaggagttc
atctacaaggaggccccactgaccaagctggccgagattaccgcccgtcttcaggagttt
tactcgcatcaacttggtggcaaaccggttgagataattaagagctccagtcgagttttt
gctgcagatctcgatgaggccattgcctacctgcagataacatatgtggaaccgcacttt
gaggaattcgagcttcgaaaacgaagactcgagtgtgaaagaaattatggaattaaacgc
tttgtgatggtgacaccattcacacaggcgggtttcgcgcatggtagcatttcggagcag
ttcaagaggaaggtgattctgacgacgtcacgatgctttccctacttgaacctgcgactc
ccggtcattggtcacgaggagttagttctttcacccatagaggttgctattgaagatgtc
gcaacgcgcaatcaacagctagcactggcaattcacacagatcctcctgatgcaaaattc
cttcaaatggtccttcaggatgaaacggctctatttcagggctgcgtgagcacgactgtg
aatcagggacccctggaggttgcggttgccttcttgaataaacggggctccccttcttcg
tcagcgtcccaagagaaccccgtcatcactgtatcagaatcagatgacgagcagcagaat
gaactccggctctgtttgaaggagtttctgcgcaaatcgcaagaggcggtgcgaatgaat
cggcagttgattggtcaagaccaggaggagtaccagcgcgagcttgaacgcaacttcgtt
caaattaaactgcaaatggagccctttttaaaacctccgatatctttccgggatttgata
actgtgggatctggggagggctacagggacagcccgaaggcaatgccgcccaacgaaagt
acaatcggcggagctttcagtgcccgctaa

DBGET integrated database retrieval system