KEGG   Echinococcus granulosus: EGR_07332Help
Entry
EGR_07332         CDS       T05553                                 

Definition
(RefSeq) Heat shock cognate protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
egl  Echinococcus granulosus
Pathway
egl03040  Spliceosome
egl04141  Protein processing in endoplasmic reticulum
egl04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:egl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EGR_07332
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EGR_07332
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    EGR_07332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egl01009]
    EGR_07332
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:egl03041]
    EGR_07332
   03009 Ribosome biogenesis [BR:egl03009]
    EGR_07332
   03110 Chaperones and folding catalysts [BR:egl03110]
    EGR_07332
   04131 Membrane trafficking [BR:egl04131]
    EGR_07332
   03051 Proteasome [BR:egl03051]
    EGR_07332
   03029 Mitochondrial biogenesis [BR:egl03029]
    EGR_07332
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egl04147]
    EGR_07332
Protein phosphatases and associated proteins [BR:egl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EGR_07332
Spliceosome [BR:egl03041]
 Complex B
  Other components
   Prp19 complex
    EGR_07332
 Complex C
   Prp19-CDC5 complex
    EGR_07332
Ribosome biogenesis [BR:egl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    EGR_07332
Chaperones and folding catalysts [BR:egl03110]
 Heat shock proteins
  HSP70 / DNAK
   EGR_07332
Membrane trafficking [BR:egl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    EGR_07332
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EGR_07332
Proteasome [BR:egl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EGR_07332
Mitochondrial biogenesis [BR:egl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    EGR_07332
Exosome [BR:egl04147]
 Exosomal proteins
  Proteins found in most exosomes
   EGR_07332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464
Motif
Other DBs
NCBI-GeneID: 36343047
NCBI-ProteinID: XP_024349057
Position
Unknown
AA seq 615 aa AA seqDB search
MSTGPAIGIDLGTTFSCVGVFQHGRVEIIANDQGNRTMPSCVAFTDKERLIGEAAKTRAG
MNPTNTVFDVKRLIGRSFNDEALQGDIKNWPFKVINSGEIPKIEVQYCGETKHFVAEEIS
SMVLSKMKETAEAYLGEEVTNAVITVPAYFNVNQRKATIDAGKLAGLNVLRLINEPTAAA
IAYGINKRSDKQRNVLIFDWGGGTFDVSILSIENGKFEVKAVGGDTHLGGEDIDSRLVDH
LVEAFEQKHKRQDLTGNKKAIGRLRKACETAKKTLSSAECTNIEVDSLFEGIDFNVILTR
ARLEQLCLDLFSRTMNAVKTALNDAKLNKADIHDIVLVGGSTRIPRVQKMLQDFFNGREL
KRSVNPDEAVAYGAALLAANLTGDESMTVEDLTLMEVTPLSLGMETEGGEMSTVIKRNTR
IPTKQVGFYKTSADNQRMASIRVYEGERAMTSKNSLLGEFLLSDLPLAPRGETRFEAVFE
IDENGILHVSAMEMLTGKQNSITITNYKGRLSEEERARMLNDAEKFKQEDEKQRSRMAAK
NRLLDYIYSIKRELRNEEVKQRTSEEYRQNILEMCEDAIKWTDAEEQATEEDYELMHKKF
ENVSSLIMATKQLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgggtcctgctattggcattgatctaggaaccaccttttcctgcgtcggtgtt
ttccaacatggcagagtggaaatcatagccaacgatcagggtaatcgcacaatgcccagt
tgtgttgcctttacagataaggaacgtcttatcggtgaagccgcaaaaacccgggctggc
atgaaccccaccaacacagtgttcgacgtgaagcgtctgatcggacgcagtttcaacgat
gaagcgttgcagggcgacattaagaattggcccttcaaagttataaattctggtgagata
ccgaagatcgaagtacagtattgtggtgaaacaaagcacttcgttgcggaggagatctca
tccatggtgctgtcaaagatgaaggagacggcggaggcctacttaggcgaggaagtcaca
aatgcagtgattactgtgcctgcgtacttcaacgtcaatcaacgaaaggccacaattgac
gcgggcaaattagctggcttaaatgtactgcgtctcatcaatgagccgacggctgctgca
attgcatacggcataaacaagaggagcgacaagcagcgcaatgtgctcatcttcgattgg
ggtggtggcaccttcgacgtgtccattctgtccatcgagaatggaaaattcgaggtaaag
gcggttggtggtgacacgcacctgggtggtgaggacatcgattcccgtctggtggatcac
cttgtggaggcgttcgagcaaaagcacaagagacaggacttgacaggtaacaagaaagcc
attggccgtctgagaaaggcgtgcgagacggcaaagaagacactgagctcggctgagtgc
acgaacatagaagtggattcgttgtttgagggtatcgatttcaatgtgatcctcacaagg
gcccgacttgaacagttgtgcttggacctcttcagtcggacgatgaatgcggtgaagacg
gcattgaatgatgcgaagttaaataaggctgacatccacgatatagtgttggtgggtgga
tcgacgcgtattccgagagtgcagaagatgctgcaggatttctttaatggtagggaatta
aaaaggtccgtcaacccagacgaggcagtggcgtacggtgcagcgttgctggcggccaat
ctgactggtgacgagtcgatgacagtggaggatttgacgttgatggaagtgacaccactt
tcactgggtatggagacggagggtggtgagatgtcgacggtgataaagcgtaacacgcga
attcccaccaagcaggtaggtttttacaaaacgtctgcagacaatcaacggatggcgtcg
atcagggtatatgagggtgagcgcgcgatgacgagtaagaacagcttgttgggtgagttt
cttctgtcagatctcccattggcacctcgtggtgaaactagattcgaagcagtctttgaa
attgacgaaaatggcattctccatgtatcggcgatggaaatgttgacagggaagcaaaat
agcatcaccatcaccaactacaagggtcgtctgtcggaagaagaaagagcgcgaatgctg
aatgatgcggagaaattcaagcaggaggacgagaagcagaggagtaggatggcagcgaag
aataggttattggactacatctacagcataaaaagggaattgaggaacgaagaggtaaag
cagaggacatcggaggaatatcgacaaaatatacttgagatgtgtgaggacgctatcaag
tggacagacgccgaggaacaggcaacagaggaggactacgaattaatgcacaagaagttt
gagaacgtgagtagccttatcatggcaacgaagcaacttggtttgtaa

DBGET integrated database retrieval system