KEGG   Echinococcus granulosus: EGR_08094Help
Entry
EGR_08094         CDS       T05553                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
egl  Echinococcus granulosus
Brite
KEGG Orthology (KO) [BR:egl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:egl03019]
    EGR_08094
Enzymes [BR:egl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     EGR_08094
Messenger RNA biogenesis [BR:egl03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     EGR_08094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Leucyl-specific
Motif
Other DBs
NCBI-GeneID: 36343809
NCBI-ProteinID: XP_024348214
Position
Unknown
AA seq 418 aa AA seqDB search
MSDRKGSTESDIAAARAQTESIRERLAARRQKRNNLIAAATQNALPLKNPDASAVAALLA
SGKLPKTLVSLTTPLASKSVTDASSSLKRADLAVKEENYVSSNEPPSEAPKVDPGTDSAD
LEILLSAVTAKERELKRVNEEIHALLSTPTVMYVHYEIDPADLTTAEAREAAGAYNRGQL
RPDSLDRGKSNLALEKAVSATTSVPLYPPQWIKCDIRQFDMTILGKFAVIMADPPWDIHM
ELPYGTMSDDEMRKMDIPCLQDDGYIFLWVTGRAMELGRECLKLWGYERVDEVIWVKTNQ
LQRLIRTGRTGHWLNHGKEHCLVGVKGSPRCMNRGLDCDVVVSEVRETSRKPDEIYGLIE
RLSPGTRKLELFGRPHNLQANWITLGNQLDGTYLVDPEVVERYRRRYPNGIDNKDDAS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcggaagggctcaactgagagtgacatcgctgcagctcgggcccaaaccgag
tcgattcgcgagagattggcagcacgaaggcagaagcggaataatttgatcgctgcagcc
acacaaaatgcgcttccacttaagaaccctgacgcttctgccgttgcagcattgttagca
tctggaaagctgcctaagaccttggtgtctttaaccacgccattggcgtccaaaagtgta
accgatgcatcgtcctcactcaaacgggccgatttagcggttaaagaggaaaattatgtt
agctctaatgagcctccctcggaagcacccaaagtggatcctggtactgattcagccgat
cttgaaatcctcctgtcagccgttaccgctaaagaacgcgagctaaaacgtgttaacgag
gagattcatgcgcttctctcgacaccgactgtgatgtatgtccactatgaaattgaccca
gccgatctaacaacagcagaggcgagagaagctgcaggcgcttataaccgaggtcaactt
cggccggatagtttggacagggggaaaagtaatttggctctggaaaaggcagtctctgca
accacttccgttcccttgtaccctccacagtggataaagtgcgacatcaggcagtttgac
atgaccattcttggcaaattcgctgtgataatggccgatccaccgtgggacatccatatg
gaactgccatatggtacaatgtccgatgatgagatgcggaaaatggacattccctgtctc
caagacgacggatatatatttctctgggtcactggacgcgccatggaattgggccgggag
tgcctcaaactctggggctacgagcgtgtggatgaggtgatttgggtgaaaactaaccag
ctgcagcgtctcatccgcacaggccgtactggccactggcttaaccacggaaaagagcac
tgtctggtgggcgtgaagggctcgccgcggtgcatgaatcgtgggctggactgtgatgtg
gttgtctcggaggtgcgcgaaactagccgcaaacccgatgagatctacggcctcattgag
cgcctctcaccggggactcgcaaacttgagctttttggacgaccgcacaatctgcaggcc
aactggataaccctagggaatcagttggacggcacatatctcgttgatccggaggtcgtg
gagcgttatcgcaggcggtatcccaacgggattgacaataaggatgatgcctcgtag

DBGET integrated database retrieval system