KEGG   Echinococcus granulosus: EGR_08413Help
Entry
EGR_08413         CDS       T05553                                 

Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
egl  Echinococcus granulosus
Brite
KEGG Orthology (KO) [BR:egl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egl04147]
    EGR_08413
Enzymes [BR:egl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     EGR_08413
Exosome [BR:egl04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   EGR_08413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase Dynein_light AAA_33 EF-hand_7 AAA_18 IstB_IS21 Mg_chelatase AAA_16
Motif
Other DBs
NCBI-GeneID: 36344128
NCBI-ProteinID: XP_024347881
Position
Unknown
AA seq 727 aa AA seqDB search
MKDDDATLAAVELSTSLMQMVQGREKRLIMGQACEKLSRRCCVSRFLRIIGVRQPPPQHV
EERLIQKYGDDSNGTDYDESPQSKDVYPFLLDREIGEWLVFTKFMIILRGPPGSGKSHLA
GCIKMHFPTTHICSADNYHLSNANHFEDYRFDSECQEAAHRDCEAEAKLYAGRGVSPLVI
DNANMRSYEYRPYTEIARLFDYNVIMVIPRTPWRFDVQSLAEKNVHHFLAETISSMISQF
EPIVYPLYYGWCFAGSPSSNSSSSLLLEKADKILPNEVTDKMIKEFHDSFFSALDVPYVR
RRLASLCGFDQDVDRDQLVTFWSSAVNPCFGSVSEPCQAVERARPHCTAFFAKYGHAPDA
SEYAQRSAVREALLGSIHTFNVEGLFITKRTVGLRVHLTDSDQFALWGGLDNELVDGYAP
AQSRPRGCRAHVTLALASGVPAAETGFDALRIMDAELAHRPDVCKIDMPDGILREILTSS
PADSESLDYTFYYQYSMPKTARLINNNNNNYNSPYRSVDMSLETVHQEFEQIDINHYGFI
TRADLENYARRTHQNDNFVDKWFEWFEGEHKGIITMEDICTTLGIPMREAYRQKVGETRQ
MISQGLISAPPEATKVFAAPPVPSSTPPVQKSLMDGVEVLQGNTAPSDIIKSCVRFVKEY
PEQLKEEKDMAHFLKVQMERQYYKHWQVVVAGSTIGCMVAHEAKKFIHFRYNNYIYILYF
VPDMSSL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgatgatgcgactttagctgctgtcgaattatctacatctttaatgcaaatg
gttcaaggtcgggagaagagacttattatgggtcaagcatgtgagaaactttccagacgg
tgttgcgtctcgcgttttcttcgtattattggagttcgtcagccgccacctcaacatgtg
gaagaacggctcattcagaaatatggtgatgactctaatggcaccgactacgatgaatct
cctcaatctaaagatgtttatccattcctcctcgatcgagaaattggcgaatggctcgtc
tttacaaagttcatgattattctcagagggccgccgggctctggaaaatcacaccttgca
ggctgcattaaaatgcattttcccactactcatatatgcagtgctgataattatcatctt
tcgaatgccaaccactttgaagattaccgatttgacagcgaatgccaggaggcagctcac
cgcgattgtgaagcagaggcaaaactgtacgctggtcggggagtaagcccccttgtcatc
gacaatgccaatatgcgatcatatgaatatcgcccatacacagagatagctcgtttattt
gactacaatgtgataatggtgataccacgaacaccttggagatttgatgttcaatctcta
gccgaaaaaaacgtccatcactttttggctgaaacgatcagttcaatgatatcgcagttt
gaaccaattgtttaccctctttattatggatggtgctttgctggctcaccaagttccaat
agtagttcgagccttttacttgaaaaggcggataaaatcctcccaaacgaagtaaccgat
aaaatgataaaagagtttcatgattccttcttctctgctttggacgtaccttatgtacgc
aggcgattggcctctctttgtggatttgatcaagatgtagatagggaccagctggtcact
ttttggtcgtcagcggttaatccctgttttggtagcgtgtctgaaccctgccaggctgtc
gaaagagctagaccacattgcaccgccttcttcgccaaatacggtcatgcccctgatgcc
tccgaatatgcgcagagaagtgccgttcgcgaggctttgttaggatccattcatacgttt
aacgtggagggtctcttcatcacaaaacggacggtcggactccgtgtccacctcaccgac
tcggatcaattcgccctttggggtggtctcgacaatgaattggtggatggatatgcacct
gctcaatcgcgaccacggggttgtcgggcccacgtgactttggccttggcgtccggtgtg
cccgcagctgaaacaggatttgacgctctgcgcattatggatgctgagttagctcaccgt
ccggatgtatgcaaaattgacatgcctgatggtatcctgcgagagattctcacatcttcg
ccggctgattccgagagtctagattacaccttctattatcagtattctatgccgaaaacc
gctcgccttatcaacaacaacaacaacaactataactccccctacagaagtgtcgatatg
agcttggagacggtgcatcaggagtttgaacaaatcgacatcaatcactacggcttcatc
actcgtgccgacttggagaattatgcacgaaggacacaccagaatgataacttcgttgat
aaatggtttgaatggtttgaaggggaacacaagggcataataacaatggaggatatctgc
acaaccctgggtataccaatgcgggaggcgtacagacaaaaagttggtgaaacaaggcag
atgatatctcaaggcctaatttcagcgcctcctgaagcaaccaaagtgtttgccgccccg
ccggtgccatcatcaacaccacctgtgcagaagtcattgatggatggtgttgaagtgttg
caggggaataccgcgcccagtgacatcattaaaagttgtgttcgttttgtcaaagaatat
cctgaacagcttaaagaggaaaaagatatggcgcacttcttgaaggtacaaatggaaaga
cagtactataaacattggcaggttgttgtggccggttcaaccatcggctgtatggttgct
catgaagcgaaaaagttcatccactttcgctataacaattacatctatatcttatatttt
gtacccgatatgagttcactgtga

DBGET integrated database retrieval system