KEGG   Echinococcus granulosus: EGR_09525Help
Entry
EGR_09525         CDS       T05553                                 

Definition
(RefSeq) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
egl  Echinococcus granulosus
Pathway
egl00350  Tyrosine metabolism
egl00360  Phenylalanine metabolism
egl00380  Tryptophan metabolism
egl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    EGR_09525
   00360 Phenylalanine metabolism
    EGR_09525
   00380 Tryptophan metabolism
    EGR_09525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egl04147]
    EGR_09525
Enzymes [BR:egl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     EGR_09525
    4.1.1.105  L-tryptophan decarboxylase
     EGR_09525
Exosome [BR:egl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EGR_09525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 36345240
NCBI-ProteinID: XP_024346826
Position
Unknown
AA seq 505 aa AA seqDB search
MQASCKAAVDKTVNYLKGVELYRPFPIVRPGFLVHQLPADPPQEGVKMETILEDVDRLLL
PGVTHWNHPHFHAYFAMANSYPAVCADIISSAIGGIGFTWASSPVSTELEVVMTNWLVKM
LGLPDFYLHNVSGGGGVIGTTCSEQAVVTMMAARNKAIEKYIADHPGATNYKAMSKLAHC
SIERAGLLNLLPFRSLPVNEKFQLTGETLESAIVEDIAMGKVPFYVCLSSTLTRARKSDI
KESGIDEFLLTPSSVRVCCAATLGTTSCCSFDRLEEIGPICKKYGLWLHVDAAYAGSAFI
CPELRRYLRGVEYTSSFAFNPHKWLLTNFDCSVVCTDAQYLKYDEVGKMPDYRNWQLSFG
RKFRSIKLWFVIRKFGVGGLQGYIRQHIRMAKYLESLIRTDPRFEIICGVVLGLVCFRIK
NNNEMTKELYKMIEEDGRIHLVTSKITGPDMKEIFFIRIAIVYLFTDEETCSFAYNVICE
IADKLMGSYQNKPANGQIRYENVSK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctcctgcaaagcagccgttgacaaaacagtgaattacctgaagggagtggag
ctgtatcgaccttttcccatcgtccgaccgggattccttgtacaccagcttccagcagat
ccaccccaagaaggcgtcaagatggagaccatcttagaggatgtggatagactgcttcta
cccggcgtaacccattggaaccacccacacttccatgcctactttgcaatggcaaattcg
tatccagctgtgtgcgctgatatcatcagcagtgccatcggaggaatcggttttacgtgg
gcttcttccccagtgagtacggaacttgaggtggttatgaccaattggctggttaagatg
ctcggccttccggatttctaccttcacaacgtcagtggtggaggtggtgttattgggacc
acctgtagtgagcaggccgttgtgacaatgatggcagctcgtaacaaggcgattgaaaag
tacattgcggatcatccgggagccacaaattacaaggctatgtcgaaacttgcgcactgt
tccattgaaagagcaggtctcctgaatcttctcccttttcggagccttccagtgaacgag
aagttccagctcacaggagaaacacttgaatcagccattgtggaagatatcgccatggga
aaagtccctttctacgtatgtctttcatctactttaacacgagcccggaaatcggacatt
aaggaaagtggcattgacgagttcctcctaacaccatctagtgtgcgtgtgtgttgtgct
gccacattgggaacaacaagctgttgcagttttgatcggttggaagagattggcccaatc
tgcaagaaatatggcctgtggcttcacgtagacgccgcgtacgcgggatctgctttcatt
tgtccggaacttcgacgttatcttcgaggagttgagtatacatcttccttcgcattcaat
cctcacaagtggctcctaaccaactttgattgttccgtcgtgtgtaccgatgctcaatac
ctgaaatacgatgaagtaggcaagatgcccgactatcggaattggcaattatcatttgga
cgcaaatttcgatcaatcaaactctggttcgtgattcgaaaattcggtgtaggcggattg
caaggttacatccgtcagcacattcgaatggctaagtatttggagtcacttatcagaacg
gatccccgatttgaaattatttgtggtgttgtactcggtctcgtctgcttccgtattaag
aataacaatgagatgacaaaagaactatacaagatgattgaggaggatggccgcattcat
ctggtaacatccaaaatcacgggcccagacatgaaggagatatttttcattcggatagcc
attgtgtacctcttcacggatgaggaaacctgcagctttgcctataatgtcatctgtgaa
attgctgacaaattaatgggtagttatcaaaacaaaccggcaaatggccaaataaggtac
gagaatgtatccaagtag

DBGET integrated database retrieval system