KEGG   Elizabethkingia bruuniana: AYC65_06060Help
Entry
AYC65_06060       CDS       T05037                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
egm  Elizabethkingia bruuniana
Pathway
egm00260  Glycine, serine and threonine metabolism
egm01100  Metabolic pathways
egm01110  Biosynthesis of secondary metabolites
egm01120  Microbial metabolism in diverse environments
egm01130  Biosynthesis of antibiotics
egm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:egm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AYC65_06060
Enzymes [BR:egm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AYC65_06060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQX87330
Position
1297321..1298355
Genome map
AA seq 344 aa AA seqDB search
MNRFSFKNDYAEGCHANILKALVETNREQQIGYGGDQYSAMARDMINERFNSPEADIYFV
SGGTQANLLTISSILRPHQSVISAESGHIFTNEAGAIEATGHKVHAARSEDGKLSPEACR
EVLDTVTNQPHVVKPKMLYISNTTELGTHYTLEELEALSGFCKENNLYLFVDGARLGHAL
TVEGTDVTPEDIARLADVFYLGGTKNGALIGEAIVIVNPELKEDFGFHVKQKGALLAKGR
LIGIQFMELMKDNLYFDLARSANQKAMKIKAAFEAYHCSFLTDSYSNQLFPIIPNSWIEK
LAEEFDFYVWKKIDEERSAIRLITSWATPEAEVDSFIASLKRLA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacagatttagttttaaaaatgattatgcagaaggatgtcatgcaaatattctgaaa
gcattggttgagaccaacagagaacaacaaattggttatggtggtgatcagtattctgcc
atggcaagagatatgattaacgaaaggtttaatagtccggaagcagatatttattttgtt
tccggaggtacacaggcaaaccttcttacgatttcttcaatactaaggccgcaccagtct
gttatttctgcagagtccggacatatatttactaacgaagcaggagctatagaggctacg
ggacataaggttcatgcagcacgatctgaagatgggaaactttctccggaagcttgtaga
gaagttctggatacggtaaccaatcagccacatgttgtaaagcctaagatgttgtatatt
tcgaatacgacagaattaggaacacattatactcttgaagagctggaagctttgtctgga
ttttgtaaagagaataatctatacttatttgtagacggagctcgtcttggccatgcactg
actgtagaaggtactgatgtaactccggaagatatagcacgtttggcagatgtgttttat
ctgggcggaaccaaaaacggagcgttaataggagaggctattgttattgtaaatccggaa
ttgaaggaagatttcggatttcatgtaaagcagaaaggagctttactagctaaaggaaga
ctaattggtattcagtttatggaactgatgaaagataacctttattttgaccttgcaaga
tccgctaatcagaaagcaatgaaaataaaagctgcatttgaagcttatcattgtagtttc
cttacggattcatacagcaatcagttatttccgattattccaaattcatggattgaaaag
cttgctgaagagtttgatttttatgtctggaagaaaatagacgaagaaagatcagcaata
aggcttataacttcatgggcaacaccggaagcagaagtggatagttttatagcatcatta
aagcgtttagcataa

DBGET integrated database retrieval system