KEGG   Elizabethkingia bruuniana: AYC65_07410Help
Entry
AYC65_07410       CDS       T05037                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
egm  Elizabethkingia bruuniana
Pathway
egm00860  Porphyrin and chlorophyll metabolism
egm01100  Metabolic pathways
egm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AYC65_07410
Enzymes [BR:egm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AYC65_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_14 HTH_45 AFP_2
Motif
Other DBs
NCBI-ProteinID: AQX84847
Position
complement(1596400..1597758)
Genome map
AA seq 452 aa AA seqDB search
MNSLVDKYNIPGPRYTSYPTVPYWDLESFSVEGWKESVIRSFKESNAEEGISIYIHLPFC
EALCTFCACHKRITKQHSVEEPYLETVLKEWQLYLNLFDEKPKLKELHLGGGTPTFFSPE
NLKKLLSGIFETVEIAEHPEFSFEGHPNNTTYDHLKTLYDLGFRRVSFGVQDYNEKVQKA
INRIQPFENVKNVTEWAREIGYTGISHDLVFGLPFQNWECMENTIRKTLELKPDRLAFYS
YAHVPWIKGVGQRGFDENDLPSGDEKRRLYEDGKSLLEELGYFEIGMDHFALPHDDLYQS
MKKGKLHRNFMGYTSSKTQLMVGLGMSGISDSWYAFAQNEKTVEGYEQMVNNGEFPVVKG
HILNEEDLIIRKHILNLMCRLETSWDTETAFPEFENAMDKLQEMQKDGLVELSENGIKIT
EEGRAFTRNVTMTFDLRMLRKQPGTRIFSMTI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattagtagataaatacaatatacctggcccgcgctatacatcttatccaacc
gttccttactgggatcttgaaagtttttctgtagagggttggaaggagtcggtgatacgt
tcttttaaagaatctaatgcggaagaagggatcagtatatatattcatcttcctttttgt
gaagctttgtgtactttttgtgcatgccataaaagaattacaaaacaacattctgtagaa
gaaccatatttggaaaccgttctgaaagaatggcagctttatctgaatcttttcgacgaa
aaaccgaagctaaaagaacttcatttaggaggaggaactcctacattcttttctccggaa
aaccttaagaaacttctcagcggaatttttgaaactgtagaaattgcggaacatcctgaa
tttagttttgaaggacatccgaataatacaacatatgaccaccttaaaacactttatgat
ctaggcttcagaagagtaagctttggtgtacaggattataatgaaaaggtgcagaaagcc
atcaacagaatacagcctttcgaaaatgtaaaaaacgtaacagaatgggctcgtgaaatt
ggctatacgggaatcagccacgatctggtatttggtttacctttccaaaactgggagtgt
atggaaaataccattcgtaaaacactggaactaaaaccagacagattagcattctattct
tacgcacacgttccgtggataaaaggtgtagggcagagaggctttgatgaaaacgatttg
ccttccggtgatgagaaacgcagattatatgaagatggtaaaagcttactggaagaatta
ggttatttcgaaataggtatggaccatttcgcattaccgcatgacgatctttatcagtct
atgaagaaaggtaaacttcaccgtaactttatgggatatacgtcttctaaaactcagcta
atggtaggcttagggatgtccggaatatccgacagctggtatgcatttgcacaaaatgaa
aaaacagtggaagggtatgagcaaatggtaaacaacggtgaattcccggtagtaaaaggg
catattctgaatgaagaagatcttattatccgtaaacatattctgaatctgatgtgcaga
ctggaaacatcatgggatacagaaactgctttccctgagtttgaaaatgcaatggacaaa
ttacaggagatgcaaaaagacggcttggttgaactctctgaaaatggtataaaaataact
gaagagggaagagcctttacccgaaatgttaccatgacatttgatctgagaatgttaaga
aaacaaccgggaacaaggatattctccatgacaatataa

DBGET integrated database retrieval system