KEGG   Elizabethkingia bruuniana: AYC65_07780Help
Entry
AYC65_07780       CDS       T05037                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
egm  Elizabethkingia bruuniana
Pathway
egm00010  Glycolysis / Gluconeogenesis
egm00053  Ascorbate and aldarate metabolism
egm00071  Fatty acid degradation
egm00280  Valine, leucine and isoleucine degradation
egm00310  Lysine degradation
egm00330  Arginine and proline metabolism
egm00340  Histidine metabolism
egm00380  Tryptophan metabolism
egm00410  beta-Alanine metabolism
egm00561  Glycerolipid metabolism
egm00620  Pyruvate metabolism
egm00625  Chloroalkane and chloroalkene degradation
egm01100  Metabolic pathways
egm01110  Biosynthesis of secondary metabolites
egm01120  Microbial metabolism in diverse environments
egm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:egm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYC65_07780
   00053 Ascorbate and aldarate metabolism
    AYC65_07780
   00620 Pyruvate metabolism
    AYC65_07780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYC65_07780
   00561 Glycerolipid metabolism
    AYC65_07780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYC65_07780
   00310 Lysine degradation
    AYC65_07780
   00330 Arginine and proline metabolism
    AYC65_07780
   00340 Histidine metabolism
    AYC65_07780
   00380 Tryptophan metabolism
    AYC65_07780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYC65_07780
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AYC65_07780
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AYC65_07780
Enzymes [BR:egm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AYC65_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AQX84913
UniProt: A0A5E8CYB5
Position
complement(1666622..1668172)
Genome map
AA seq 516 aa AA seqDB search
MAKTNQSFKIEKSLQHLGISKDNKGASSGTKFFATGKSIDSYSPVDGKLIASVKTASEKD
YEKIIKLAQQASSEFRLMPAPKRGEIIRQFGLKLREYKEDLGKLVSYEMGKSLQEGWGEV
QEMIDICDFAVGLSRQLHGFTMHSERSQHRMYEQYHPLGIVGIISAFNFPVAVWSWNAAL
ALICGNAIIWKPSEKTPLCAVACQNIMAEVLKENKLPEGISNLVISDHVIGQKMVESKDV
QLISFTGSTAVGREVASKVAGRFGKSILELGGNNAIIITENADLEMSIIGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVKTKLVKAYGQLKIGNPLDVENHVGPLIDDHAVKQYENSIAK
CKKEGGKFIVEGGLLKGKEYASGCYVKPCIAEVKNSYEIVQHETFAPILYIMKYKTLEEA
IAMQNDVPQGLSSAIMTQNLREAELFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGG
GRESGSDAWKYYMRRQTNTINYGKDLPLAQGIKFNI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaccaatcaaagttttaaaatcgaaaaatctcttcagcatcttggaatctct
aaagacaataaaggtgcttcttccggaaccaaattttttgcaaccgggaaatctattgac
tcttattcaccggtagatggtaaactaatcgcaagcgtgaaaacagcttctgaaaaggat
tatgagaagattatcaaacttgcacagcaggcttcttctgagttcaggttaatgcctgca
cccaaaagaggagaaatcatcagacaattcggattaaagctgagagaatataaagaggat
cttggtaagctggtttcttatgaaatggggaaatctcttcaggaaggctggggagaggtg
caggaaatgattgatatctgtgatttcgcagtcggattatcccgtcagttacacggattt
actatgcattcggaacgttcgcaacacagaatgtatgaacaatatcatccacttggaatc
gtaggaattatatcagcttttaatttcccggtagcggtatggagctggaatgcagcattg
gccctaatatgtggaaatgctattatatggaagccttcagaaaaaacaccactttgtgct
gtagcttgtcagaatattatggccgaagttctgaaagagaataagctgccggaaggaatt
tccaatcttgtaatcagcgatcatgtaataggacagaagatggtcgaaagtaaagatgtc
cagttgatatcatttacaggttctacggctgtaggaagagaagttgcttccaaagttgcc
ggacgtttcggtaaatctatcttagaattaggcggtaacaacgctattatcatcactgaa
aatgcggatctggaaatgtctattatcggtgcagtatttggtgcggtcggaacagcaggg
cagagatgtacttctacaagacgattgattatccacgaaagtgtatatgataaagttaag
actaagcttgtaaaagcttatggtcagctgaaaataggaaatccattagatgtggaaaat
catgtaggtccactaatcgatgatcatgcagtaaaacaatacgaaaattccattgctaag
tgcaaaaaagaaggcgggaaatttattgttgaagggggtctgctaaaagggaaagaatat
gcttcaggctgttacgtaaagccttgtatcgctgaagtgaaaaattcatacgaaattgta
cagcatgaaacttttgcccctattctttatattatgaaatataagacgcttgaagaagct
attgctatgcaaaatgatgttccgcagggactttcttcagcaattatgactcaaaacctg
agagaagcggagttattcctgtctcacgcaggatctgattgcggaattgcaaatgtaaat
atcgggacatccggagcggagattggcggagcattcggtggagaaaaggaaactggcggt
ggaagagaatcaggatcggatgcatggaaatattacatgagaagacagactaatacaatt
aattatggtaaggatttaccattagctcagggaatcaaatttaatatttaa

DBGET integrated database retrieval system