KEGG   Erythrobacter gangjinensis: BMF35_a1472Help
Entry
BMF35_a1472       CDS       T04581                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
egn  Erythrobacter gangjinensis
Brite
KEGG Orthology (KO) [BR:egn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BMF35_a1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APE28301
UniProt: A0A0G9MP88
Position
I:1515756..1516172
Genome map
AA seq 138 aa AA seqDB search
MTRAALNSLFQHVAITAGVTVRVSVNFMPEQSRVGAGRWFWVYHIRIENGRDERVQLKSR
HWRITDSSGMVNVVDGEGVVGEMPVLQPGETHDYVSGCELTTNQGAMEGHYGFVHADGEP
FQVAIPRFELAAPENSSV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgccgcgctcaattcgctgttccagcatgtcgccatcaccgcaggggtgacg
gtgcgcgtgtcggtcaatttcatgcccgagcaatcgcgcgtcggcgcggggcgctggttc
tgggtgtatcacatccgcatcgagaacgggcgtgacgagcgcgtgcagctgaaaagccgc
cactggcgcatcaccgatagcagcggcatggtgaatgtcgtggacggtgaaggcgtggtg
ggcgagatgccggtactccagccgggcgaaacgcacgattacgtgtccggctgcgagctg
acgaccaaccagggggcgatggaaggccattacggcttcgtccacgccgatggcgagccg
ttccaggtggcaatcccgcgtttcgaactggcggcgcctgaaaatagtagtgtttga

DBGET integrated database retrieval system