KEGG   Erythrobacter gangjinensis: BMF35_a2016Help
Entry
BMF35_a2016       CDS       T04581                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
egn  Erythrobacter gangjinensis
Pathway
egn00071  Fatty acid degradation
egn00072  Synthesis and degradation of ketone bodies
egn00280  Valine, leucine and isoleucine degradation
egn00310  Lysine degradation
egn00362  Benzoate degradation
egn00380  Tryptophan metabolism
egn00620  Pyruvate metabolism
egn00630  Glyoxylate and dicarboxylate metabolism
egn00640  Propanoate metabolism
egn00650  Butanoate metabolism
egn00900  Terpenoid backbone biosynthesis
egn01100  Metabolic pathways
egn01110  Biosynthesis of secondary metabolites
egn01120  Microbial metabolism in diverse environments
egn01130  Biosynthesis of antibiotics
egn01200  Carbon metabolism
egn01212  Fatty acid metabolism
egn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:egn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMF35_a2016
   00630 Glyoxylate and dicarboxylate metabolism
    BMF35_a2016
   00640 Propanoate metabolism
    BMF35_a2016
   00650 Butanoate metabolism
    BMF35_a2016
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMF35_a2016
   00072 Synthesis and degradation of ketone bodies
    BMF35_a2016
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMF35_a2016
   00310 Lysine degradation
    BMF35_a2016
   00380 Tryptophan metabolism
    BMF35_a2016
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMF35_a2016
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMF35_a2016
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMF35_a2016
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egn04147]
    BMF35_a2016
Enzymes [BR:egn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMF35_a2016
Exosome [BR:egn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMF35_a2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: APE28845
UniProt: A0A0G9MQH5
Position
I:2063294..2064490
Genome map
AA seq 398 aa AA seqDB search
MATFNESDPIVILSYARTPMGAMQGALADVAATDLGATAAKAAIERAGVSGDDVNRVYMG
CVLPAGLGQAPARQVAILAGLPKSAQATTVNKVCGSGMQTVIMGAESLASGTSDVVLAGG
MESMTNAPYLLKKHRSGARIGHDKAYDHMFLDGLEDAYEEGRAMGTFAQDMADKYQLTRE
SMDEYSIASLDRANKAIESGAFADEVVPVTYTTRRGDVTVDTDEAPGKGNPDKIPQLRPA
FAKDGTITAATSSSISDGAAAVVLSRKSVADEKGLTPVATVVGMTAHAQAPEEFTIAPVG
AIQKLLEQTGWSVDDVDLWEVNEAFACVAMFAMKDIGIDHAKINVNGGGTALGHPIGASG
TRIIVTLLNALKQQGKKRGIASLCIGGGEATAVAVELA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctactttcaacgaatccgatcccatcgtcatcctttcctacgcacgcaccccgatg
ggcgccatgcagggcgcgctggccgatgtcgccgcgacagacctgggtgcaacggcagcg
aaggcagccatcgaacgcgccggtgtatcgggagacgatgtgaaccgggtctatatgggc
tgcgttttgcccgccggtctcggccaggcccctgcccgccaggtagcgatccttgcagga
ctgcccaagagtgcgcaggcgaccacggtgaacaaggtttgcggcagcggcatgcagacc
gtcatcatgggcgcggaatcgctcgcctcgggcacctcggatgtcgtgctcgcaggcggt
atggagagcatgaccaatgcgccctacctgctgaaaaagcaccgctccggcgctcgcatc
gggcatgacaaggcgtatgaccacatgttcctcgacggactggaagatgcctatgaggaa
ggccgcgccatgggcacgttcgcgcaggacatggccgacaagtatcagctgacgcgcgag
agcatggacgaatattccatcgccagcctggaccgcgccaacaaagccatcgaaagcggt
gcattcgcggacgaggtcgtccccgtcacctacaccacgcgccggggcgatgtgactgtc
gatacggacgaagcgcccggcaagggcaaccccgacaagatcccgcagctgcgtccggcc
tttgccaaggacggcaccatcacggcggcgacctcctcctccatctccgacggcgcggct
gcggtggttctctctcgcaagagcgtagccgacgagaaaggcctgacaccggtcgcgacc
gtggtcggcatgaccgcccacgcgcaggctccggaagagttcacgatcgctcccgtgggc
gcaatccagaagttgctcgagcagaccggctggagcgtcgacgatgtcgatctctgggaa
gtgaacgaggccttcgcctgcgtcgccatgttcgcgatgaaggacatcggcatcgatcac
gccaagatcaacgtgaatggcggcggcaccgctctgggccaccccatcggtgccagcggc
acgcgcatcatcgtgactttgctcaatgctctcaagcagcagggcaagaagcgcggcatc
gcatcgctgtgcatcggtggcggcgaagcgacggcggtggctgtcgaactagcctga

DBGET integrated database retrieval system