KEGG   Erythrobacter gangjinensis: BMF35_a2184Help
Entry
BMF35_a2184       CDS       T04581                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
egn  Erythrobacter gangjinensis
Pathway
egn00900  Terpenoid backbone biosynthesis
egn01100  Metabolic pathways
egn01110  Biosynthesis of secondary metabolites
egn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:egn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMF35_a2184
Enzymes [BR:egn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BMF35_a2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom NmrA
Motif
Other DBs
NCBI-ProteinID: APE29013
UniProt: A0A0G9MRE8
Position
I:complement(2243835..2244989)
Genome map
AA seq 384 aa AA seqDB search
MTRSISIFGATGSIGDSTLDLLRSDRDAWDVAALSANCSAEKLATLAREFGAKLAVVGDE
SCLPELRQHLDGSGIEATGGKQALCDAAAMPVDISVAAIVGCAGLGPTMAAIEQGHTVAL
ANKEALVSAGEVMTAKVAEHGTTLLPVDSEHNAIFQCLEGNDLADVRWITLTASGGPLRT
KSLAELEAVTPEQAVAHPNWDMGAKISVDSATMFNKGLEFIEAYHLFPIGLDALRIIVHP
QSVIHSMVEYRDGSTLAQLGPSDMRVPIASALAYPARMDTDLKPLDLANIGELTFFAPDE
ERFPATKLAREAAHAGGAAPAVLNAANEVAVAAFLDGQIRFTQISAIVARTLDNYAPPAP
ASLDDVLAVDAEARACAAEMMEPA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctccatttccatcttcggggccaccggctctatcggcgattccacgctcgac
ctgctgcggagcgatcgcgatgcgtgggatgtcgccgcgctcagcgccaattgctcggcg
gagaagctggcgactttggcgcgcgaattcggcgcaaaactggcggtggtaggggatgaa
agctgcctgccggaattgcggcaacatttggacggatcaggtatcgaggcgaccgggggc
aagcaggcgctgtgcgatgcggctgccatgccggtcgatatcagcgtggccgccatcgtc
ggctgcgcagggcttggcccgaccatggccgcgatagagcagggccacaccgtcgcgctc
gccaacaaggaagcgctggtttcggctggcgaggtaatgaccgccaaggttgccgagcat
ggcacaacgctgctgccggtcgatagcgagcacaatgccatcttccagtgcctggaagga
aacgaccttgccgatgtgcgctggatcacgctcacagccagtggcggtccgctgcgcacc
aaatcgctggccgaacttgaagcggtcacgcccgagcaggctgtcgcgcacccgaattgg
gacatgggcgccaagatcagcgtcgatagtgccaccatgttcaacaaggggctggaattt
atcgaggcttaccacctcttcccaatcgggctggatgccttgcgcatcatcgtccacccg
caaagcgtgatccactcgatggtcgagtatcgcgacggatctacgctggcgcagctgggg
ccgagcgacatgcgcgtgcccatcgccagcgcgctggcctatccggcgcgcatggacacc
gatctaaagccgctggacctagccaacattggcgagctgacgttttttgcacccgatgaa
gagcgctttcccgcaacgaaactggcacgagaagcggcccatgctggcggtgcggcgccg
gcagtgctcaatgccgcgaacgaggtggccgtcgcggctttcctcgacggtcagatcagg
ttcacgcaaatttcggcaatagtggctagaactctcgacaattacgcgccgccagcgccc
gccagcctcgacgatgtcctcgccgtcgatgccgaggcgagggcatgtgcggctgagatg
atggagcccgcctag

DBGET integrated database retrieval system