KEGG   Erythrobacter gangjinensis: BMF35_b0077Help
Entry
BMF35_b0077       CDS       T04581                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
egn  Erythrobacter gangjinensis
Pathway
egn00780  Biotin metabolism
egn01100  Metabolic pathways
Module
egn_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:egn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMF35_b0077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:egn01007]
    BMF35_b0077
Enzymes [BR:egn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BMF35_b0077
Amino acid related enzymes [BR:egn01007]
 Aminotransferase (transaminase)
  Class II
   BMF35_b0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SHMT
Motif
Other DBs
NCBI-ProteinID: APE29332
UniProt: A0A0G9MP47
Position
II:complement(78305..79459)
Genome map
AA seq 384 aa AA seqDB search
MLDHIRQSLDRIAEKDRMRALKVAQLADGGRIMRDGRELLDLSSNDYLGLARHPLLTETA
ANFAREYGAGSGASRLITGTSAAHETVDARIAAFKGTETALVMASGWQANAGIIPALAKA
APTTAIFADELVHNSIHAGCRAARADVHFYAHNDAEDLERLLTTRGAGVDARIIITESCF
SMDGDLADLPALNALADKHGALLYVDEAHATGVLGRGGAGLTADHAGAALVMGTFSKALG
GFGAYVACSALLRDYLVNMCPGLIFSTAPPPAVLGAMSAALELVPTMDGERAHLAKLSQR
MRDGLQGLGYDTLGSASQIVPLVVGSEKDALALGEHLLEAGIAGLPIRPPTVPKGTSRIR
LALRSTLSSEDVDLVLDCVSTWRR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcacatccgccagtcgctggatcgtattgccgagaaagaccggatgcgcgcg
ctgaaggtcgcgcaactggccgatggcgggcggatcatgcgcgatggacgcgaattgctg
gacctctccagcaacgactatctcggcctcgcccgacatccgctgctgaccgagacggcg
gccaatttcgcccgcgaatacggcgcagggtcgggcgcctcgcgcctcatcaccggcaca
tctgcggcgcatgagacggtcgacgcgcgcatcgcggcgtttaagggcacggaaacggcg
ctggttatggcgagcgggtggcaggccaatgcggggatcatccccgcgcttgccaaagca
gcgcctaccaccgcgatcttcgccgacgaattagtgcacaattccatccatgccggatgc
cgggccgcgcgggccgatgtgcatttctacgcgcataacgatgcggaggacctggaacgg
ctgctgacgacgcgcggcgcgggagtggatgcgcggatcatcatcacggagagctgcttc
agcatggatggcgacctcgccgacttgcctgcgctcaatgcgctcgccgataagcatggc
gcgctgctttacgtggacgaggcgcatgcgacgggcgtgctgggcagaggcggcgcgggg
ctgacggcggaccatgccggcgcggcgctggtcatgggcactttcagcaaagcgctgggc
gggttcggggcctatgttgcctgctctgcgctgctgcgcgattacctcgtcaacatgtgc
cccggcctgatcttttccaccgcaccgccgcccgccgtgctgggcgcgatgtcggcggcg
ctggaactggtgccgacgatggatggcgagcgggcgcatcttgcaaagctgtcgcagcga
atgcgcgatgggttgcaagggcttggttacgacacgctcggctccgccagccagatcgtg
ccgctggtcgtagggtcagaaaaggacgctctggcgctcggcgagcacctactggaggct
ggcattgccggtcttccgatccgtccgcccaccgtacccaaaggcaccagccgcatccgt
ctggcgctgcgatcgacactgtcgagcgaggatgtcgatcttgtgctggattgcgtgtcg
acatggcggcggtga

DBGET integrated database retrieval system