KEGG   Elizabethkingia ursingii: BBD34_01035Help
Entry
BBD34_01035       CDS       T05036                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ego  Elizabethkingia ursingii
Pathway
ego00260  Glycine, serine and threonine metabolism
ego01100  Metabolic pathways
ego01110  Biosynthesis of secondary metabolites
ego01120  Microbial metabolism in diverse environments
ego01130  Biosynthesis of antibiotics
ego01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ego00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBD34_01035
Enzymes [BR:ego01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBD34_01035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQX10640
UniProt: A0A1T3FSB4
Position
complement(221822..222856)
Genome map
AA seq 344 aa AA seqDB search
MNRFSFKNDYAEGCHANILKALVETNREQQIGYGGDQYSAMAKDMIKERFNSPEADIYFV
SGGTQANLLTISSMLRPHQSVISAESGHIFTNEAGAIEATGHKVHAARSEDGKLSPEACR
EVLDTVTNQPHVVKPKMLYISNTTELGTHYTLEELEALSGFCKENNLYLFVDGARLGHAL
TVEGTNVTPEDIARLADVFYLGGTKNGALIGEAIVIVNPELKEDFGFHVKQKGALLAKGR
LIGIQFMELMKDNLYFDLAKSANQKAMKIKAAFEAYHCSFLTDSYSNQLFPIIPNSWIEK
LAEEFDFYVWKKIDEEKSAIRLITSWATPEAEVDSFIASLKRLA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatttagttttaaaaatgattatgcagaaggatgtcatgcaaatattctgaag
gcattggttgagacgaatagagaacaacaaattggttatggtggcgatcagtattctgcc
atggcaaaagatatgattaaagaaaggtttaatagtccggaagcagatatttattttgtt
tccggaggtacacaggcaaaccttcttacgatttcttcgatgctacggccacatcagtct
gttatctctgcagagtccggacatatatttaccaacgaagcaggagctatagaggctacg
ggacacaaagttcatgcagcaagatccgaagacggaaagctttctccggaagcctgtaga
gaagttttggatacggtaaccaatcagccacatgttgtaaagcctaaaatgctgtatatt
tcgaatacaacagaattaggaacacattatactcttgaagaactggaagctttgtctgga
ttttgtaaagagaataacctatacttatttgtagacggagctcgtcttggtcatgcactg
actgtagaaggtactaatgtaactccggaagatatagcacgtttggcagatgtattttat
ctggggggaaccaaaaacggagcattgataggagaggctattgttattgtaaatccggag
ttaaaggaagattttggttttcatgtaaagcaaaaaggagctttattggccaaaggaaga
ctgattggtattcagtttatggaactgatgaaagataatctttattttgatcttgcaaaa
tccgcgaatcagaaagcaatgaaaataaaagctgcatttgaagcttatcattgtagtttt
cttacagattcctatagcaatcagctatttccgattattccaaattcctggattgaaaag
cttgctgaagaatttgatttttatgtctggaagaaaatagacgaagaaaaatcagcaata
aggctcattacttcatgggcaacaccggaagcagaagttgacagctttatagcatcatta
aagcgtttagcataa

DBGET integrated database retrieval system