KEGG   Elizabethkingia ursingii: BBD34_17625
Entry
BBD34_17625       CDS       T05036                                 

Definition
(GenBank) flavastacin
  KO
K20138  flavastacin [EC:3.4.24.76]
Organism
ego  Elizabethkingia ursingii
Brite
KEGG Orthology (KO) [BR:ego00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ego01002]
    BBD34_17625
Enzymes [BR:ego01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.76  flavastacin
     BBD34_17625
Peptidases and inhibitors [BR:ego01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   BBD34_17625
SSDB
Motif
Pfam: Astacin RicinB_lectin_2 Ricin_B_lectin DUF3810 Reprolysin_5 GW
Other DBs
NCBI-ProteinID: AQX10342
UniProt: A0A1T3F3R3
Position
3884378..3885709
AA seq 443 aa
MTRKLLILSGCLVLALNSCKSDMEATPASSVDHTATQLNGTTIHKLLINGAYTYVNEVNG
EYFYADDITISAEQFNQLKRMANRDISTVERSTIVSSFIKTWPNATVYYTLPSQGSLSTQ
AYNTFLTNINKAFDMISSKTSVKFIQRTNQPEYITFTYSTGNSSPLGWVKNRVNGIKIYN
TTYPAIIAHEIMHSMGIMHEQCRPDRDQYIIVDTNRAQDGTRHNFNLYNDYAGHGEFDFG
SVMMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNSTSATNGTYT
LTTSLAGDKNVDITGSSTANGTDVILYSATTGNNQKFIFRKSEHGYFTIKSILDSTKVLT
VRNNGTANGTAVELRTIADTDNQKWLLFNLGNEGFGFAPKNAPSLRLEVKDGLTTNLTPI
VIGSTDQTLQPYTKQRFTLTKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgacacgtaaactattaatcttatcaggctgcctggttctggctctgaattcttgtaag
tcggatatggaagctactccagcaagttcggttgatcatacagcaactcagctgaacgga
acaaccattcacaaattattaattaacggagcttatacttatgtaaatgaagttaatggc
gaatacttttacgctgatgatattacaatctcggcggaacagtttaaccagttgaagaga
atggccaatcgggatatatctactgttgagcgtagtacaattgtaagttcttttatcaaa
acctggccaaatgcaacagtttactatactttgcctagtcagggaagtttaagtactcag
gcttataatactttccttacgaatattaacaaggcgtttgatatgatctcttcaaagacc
agtgttaagttcattcaacgtaccaatcaacctgaatatattacatttacttattccacc
ggaaacagctctccactgggttgggtaaaaaacagagtcaatggtattaaaatttataat
acaacttatcctgccattattgcccacgaaattatgcattcaatggggattatgcatgag
cagtgccgcccggacagagatcagtacatcatagtagatacaaacagagcacaggatggt
acccgtcacaatttcaatctttataatgattatgcaggacatggggagttcgactttggt
tcggtgatgatgtataaatctacggactttgcgatagatcctaatctgcctgtaatgaca
aaactggatggttctacattcggaaaacaaagagatggcctgtctgcaggtgattatgca
ggtatcaatcatttgtacggaccagtaaattccacatctgctactaacggaacgtataca
cttacaacttctttagcaggagataaaaatgttgatattaccggaagctcaacagctaat
ggtacagatgtaatcctttattctgcaactacaggaaacaatcagaaatttatcttccgc
aaatcggagcatggttatttcaccattaaatcgatactggattctacaaaagtattgaca
gtaagaaataatgggacagcaaacggaacggctgtagaacttagaaccattgcggatacg
gataatcagaaatggttgctatttaatttaggaaatgaaggttttggttttgctcctaaa
aatgctccatccctaagactagaggtaaaagatggtctgacaactaatcttactcctatt
gttattggaagtacagatcagacgcttcagccttatacaaaacaacgctttacgcttaca
aaagtaaactaa

DBGET integrated database retrieval system