KEGG   Eucalyptus grandis (rose gum): 104420043Help
Entry
104420043         CDS       T03547                                 

Definition
(RefSeq) probable xyloglucan 6-xylosyltransferase 5
  KO
K08238  xyloglucan 6-xylosyltransferase [EC:2.4.2.39]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:egr01003]
    104420043
Enzymes [BR:egr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.39  xyloglucan 6-xylosyltransferase
     104420043
Glycosyltransferases [BR:egr01003]
 Polysaccharide
  Structural polysaccharide
   104420043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_34
Motif
Other DBs
NCBI-GeneID: 104420043
NCBI-ProteinID: XP_010030248
UniProt: A0A059CZP6
Position
Unknown
AA seq 449 aa AA seqDB search
MGQDGFTPQKRTSSSLPTTAANGRHASRIIPRGRQIQKTFNNIKITLLCGFVTILVLRGT
IGVGNLGSSDADAVNQNLIEETNRILAEIRSDSDPIDPDDPPEAEINLNVTYALGPKIST
WDTDRKNWLESNPEFPSHVNGKPRILLLTGSQPNPCDNAIGDHYLLKAVKNKIDYCRIHG
IEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTDMVFEIPLSKYDK
HNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTA
NLKGRPAFEADDQSALIYLLISQKDKWMDKVFVENSYYLHGYWLGLVERYEEMIEKYHPG
LGDERWPFVTHFVGCKPCGSYGDYPVEKCLGSMERAFNFADNQVLKLYGFRHRGLLSPKI
RRIRNETVTPLEFVDQFDIRRPVHGNSRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaggacgggttcaccccccagaagcgcacctcctcctccctgccgaccaccgcc
gccaacggccggcacgcgtcccgcatcatcccccgggggcggcagatccagaagacgttc
aacaacatcaagatcacgctcctctgcggcttcgtcacgatcctcgtcctccgcggcacg
atcggcgtgggcaacctcgggagctccgatgccgacgccgtcaaccagaacctgatcgag
gagaccaaccggatcctcgccgagatccggtccgactccgaccccatcgacccggacgac
ccgcccgaggccgagatcaatctcaacgtcacctacgcgctgggccccaagatctcgact
tgggataccgaccgcaagaattggctcgagagcaatcccgagttccccagccacgtcaat
ggtaagcctcggattttgctcctaactgggtcgcagccgaacccttgcgataacgcgatt
ggggaccactatttgttgaaggctgttaagaacaaaattgactattgtaggattcatggg
attgagattgtgtataatatggctcatttggataaggagcttgctgggtattgggccaaa
ttgcccatgattaggaggttgatgttgtcacaccctgaggtggagtggatttggtggatg
gacagtgatgctttgttcactgatatggtgtttgagatcccgctttcgaagtatgataag
cacaatttggttattcacgggtaccctgatctgttgtttgatcagaagtcgtggattgct
ttgaacactggaagctttctctttaggaattgccagtggtcattggatttgcttgatgct
tgggcaccgatgggcccgaaggggccaatccgtgatgaggctgggaagattttgactgct
aatctgaaaggaaggccggctttcgaggcggatgatcagtctgctttgatatacttgctg
atttctcagaaggataagtggatggataaggtgttcgttgagaattcttattatttgcac
ggttattggttgggattggtggaacggtatgaagagatgattgaaaagtatcatcctggt
ttgggagacgagaggtggccatttgtgactcatttcgtgggttgtaagccttgtgggagt
tatggggattacccagttgagaagtgcctaggaagcatggagagggcattcaattttgca
gacaatcaagtgctcaaactgtatgggttcagacatcggggcctgttgagtcccaagatc
aggagaatacgaaatgaaactgttactcctttggagtttgtagaccagtttgatattcgc
cgaccggtacatggaaatagcagatcatag

DBGET integrated database retrieval system