KEGG   Eucalyptus grandis (rose gum): 104420900Help
Entry
104420900         CDS       T03547                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr03040  Spliceosome
egr04141  Protein processing in endoplasmic reticulum
egr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:egr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104420900
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104420900
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104420900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egr01009]
    104420900
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:egr03041]
    104420900
   03009 Ribosome biogenesis [BR:egr03009]
    104420900
   03110 Chaperones and folding catalysts [BR:egr03110]
    104420900
   04131 Membrane trafficking [BR:egr04131]
    104420900
   03051 Proteasome [BR:egr03051]
    104420900
   03029 Mitochondrial biogenesis [BR:egr03029]
    104420900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egr04147]
    104420900
Protein phosphatases and associated proteins [BR:egr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104420900
Spliceosome [BR:egr03041]
 Complex B
  Other components
   Prp19 complex
    104420900
 Complex C
   Prp19-CDC5 complex
    104420900
Ribosome biogenesis [BR:egr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104420900
Chaperones and folding catalysts [BR:egr03110]
 Heat shock proteins
  HSP70 / DNAK
   104420900
Membrane trafficking [BR:egr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104420900
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104420900
Proteasome [BR:egr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104420900
Mitochondrial biogenesis [BR:egr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104420900
Exosome [BR:egr04147]
 Exosomal proteins
  Proteins found in most exosomes
   104420900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C B12-binding_2 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 104420900
NCBI-ProteinID: XP_010030977
Position
Unknown
AA seq 649 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGAGGMDEDGPSAGGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaaggagaggggccggctatcggcatcgacctcgggacgacgtactcgtgc
gtcggcgtgtggcagcacgaccgcgtcgagatcatcgccaacgaccagggcaaccgcacc
accccgtcctacgtcgccttcaccgacaccgagcgcctcatcggcgatgccgccaagaac
caggtcgccatgaaccccatcaacaccgtcttcgatgctaagcggttgattggaaggaga
ttcgctgacgcctcagttcagagcgatatcaagcactggcctttcaaggtcactcccggc
cctggtgataagcccatgattgttgtcaactacaagggtgaagagaagcagtttgctgct
gaggaaatttcctccatggttcttacaaagatgcgtgagattgccgaggcctacctgggc
tcgactattaaaaatgcagttgtcactgtccctgcctacttcaatgactctcagaggcag
gccaccaaggatgccggtgtcattgcagggctcaatgtcatgcgtatcattaatgagcca
actgctgcggccattgcttatggtctcgataagaaggccaccagtgtgggagagaagaat
gtgttgatcttcgaccttggtggtggtacttttgatgtgtccctcctaaccattgaggag
ggtatctttgaggtgaaggcaacagctggagacactcatcttggtggtgaggactttgat
aacagaatggtgaaccactttgtgcaagagttcaagaggaagcacaagaaggacatcagt
ggaaacccgagggctctaaggagattgaggacagcttgtgaaagggcgaagagaactctc
tcctccactgctcagacgacaatcgaaattgactctctgtacgagggtgtggatttctac
tccacaatcactcgtgccagatttgaggagctcaacatggaccttttcaggaagtgtatg
gagccagttgagaagtgcctcagggatgcaaagatggacaagagcactatccacgatgtt
gtccttgtgggtggttccactaggatccccaaggtgcagcagctattgcaggatttcttc
aacgggaaggagctctgcaagagcattaaccctgatgaagctgtggcttatggtgcggcg
gttcaagctgcaattttgagtggtgagggtaatgagaaggtccaggacttgttgctgctg
gatgtcacccccctctctcaaggtttggaaaccgctggaggtgtcatgactgtcttgatc
ccaagaaacaccaccatccccaccaagaaggagcaggtgttctctacctactcggataac
caacctggagtccttatccaggtttacgagggtgagagagccagaactagggacaacaat
ttgttgggcaagttcgagctctcaggcattcctccggcacctaggggcgttccccaaatt
actgtctgcttcgacatcgatgcgaacggtatcttgaatgtctctgctgaggacaagacc
actggccagaagaacaaaattaccatcaccaatgacaagggaaggttgtccaaggaggag
attgagaagatggtccaggaagctgagaaatacaagtctgaggatgaggagcacaagaag
aaggtggatgctaagaatgctctggagaactatgcctacaacatgaggaacacgatcaag
gatgagaagatcagtgccaagctctccgaaggggacaagaagaagatcgaagacgccatc
gaccaagccatacagtggttggactcgaaccagctggccgaggcggacgagtttgaagac
aagatgaaggagctcgagagcatctgcaaccccatcattgccaagatgtaccagggtgct
ggtgcggacatgggtgctggtggcatggatgaagatggtccctcagctggtggtagcggt
gctgggcccaagattgaggaggtcgactaa

DBGET integrated database retrieval system