KEGG   Eucalyptus grandis (rose gum): 104421700Help
Entry
104421700         CDS       T03547                                 

Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:egr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104421700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egr01001]
    104421700
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104421700
Protein kinases [BR:egr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104421700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 104421700
NCBI-ProteinID: XP_010032056
UniProt: A0A059ACB4
Position
Unknown
AA seq 373 aa AA seqDB search
MADAAAQNGQFSDFPAVPTHGGQFIQYNIFGNHFEITAKYRPPIMPIGRGAYGIVCSVLN
SETNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVIPPPLRREFTDVYI
AMELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCD
LKIIDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKP
LFPGRDHVHQMRLLVELLGTPADADLGFVRNEDARRYIRQLPQHPRQPLASVFPHVHPLA
IDLVEKMLTFDPTKRITVEEALAHPYLTRLHDIADEPVCRQPFSFEFEQQPLGEEQMKDM
IYQEAIALNPEFA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgccgcagctcagaacggccagttcagcgacttcccggcggtcccgacccac
ggcggccagttcatccagtacaacatcttcggcaaccacttcgagattacggccaagtac
cggccgccgatcatgccgatcggccgcggcgcgtacggcatcgtctgctctgttctgaac
tcggagacgaacgagatggtggcgatcaagaagatagcgaacgcgttcgacaaccacatg
gacgccaagcggacgctccgcgagatcaagctgctccgccatctggaccacgagaacgtt
attggcattagagatgtgattcctcctcccctacggcgagaatttactgatgtctacatt
gctatggaactcatggacactgatcttcaccaaattattcgttcaaaccaaggcttgtca
gaagagcactgtcagtacttcttgtatcagattctacgtggactgaagtatatccactct
gcgaatgttattcatagagacttgaaacccagcaatcttttgctgaatgccaattgtgac
ctgaagatcattgactttggcctggcacggccaactgcagaaaatgaatttatgactgaa
tatgtggtcaccagatggtacagggcaccagaattgctgttgaactcttcagattatact
gctgctatagatgtgtggtctgttggttgcatatttatggagcttatgaacagaaagcct
ttgttccctgggagggatcatgtgcatcagatgcgtttgcttgtagagcttcttggtaca
ccagctgatgccgatcttgggtttgtgcgaaatgaggatgcacgccgatacataagacag
cttcctcagcatccccgtcaaccattggctagtgtttttcctcatgttcaccctttggcc
atcgatctggttgagaagatgttgacatttgacccaacaaagagaatcacagttgaagaa
gcactcgcccatccttatcttacgagattacacgacatagctgatgaacctgtgtgccga
caaccattttcttttgagtttgagcaacagcccttgggagaagagcagatgaaggacatg
atatatcaggaggctatagcgctcaatccagagtttgcttga

DBGET integrated database retrieval system