KEGG   Eucalyptus grandis (rose gum): 104422337Help
Entry
104422337         CDS       T03547                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egr01001]
    104422337
   01009 Protein phosphatases and associated proteins [BR:egr01009]
    104422337
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104422337
Protein kinases [BR:egr01001]
 Serine/threonine kinases: Other
  Wnk family
   104422337
Protein phosphatases and associated proteins [BR:egr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104422337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 104422337
NCBI-ProteinID: XP_018719922
UniProt: A0A059AF60
Position
Unknown
AA seq 622 aa AA seqDB search
MYRIQAGSAAAAGVEPGYCVETDPTGRYARFEEILGKGATKTVYKAIDEVLGMEVAWNQV
KLNDSFRSPDEYQRLISEVHLLSTLNHDSIMKFHTSWVDVDGTAFNFITEMFTSGTLRNY
RKKYPRLHIRAIKNWAVQILHGLVYLHSHDPPVIHRDLKCDNLFVNGHLGQVKIGDLGLA
AILHGSRAAHSIIGTPEFMAPELYDENYNELVDVYSFGMCVLEMLTCEYPYIECTNPAQI
YKKVTSGKLPEAFYRIKDSKARKFIGKCLANVSCRVSARELLHDPFLLSDEGDRLPGLKF
KMPEPFLNGRDVDNLRARDNPLRTDMMITGKLNPEGDTIFLKVQIADRNGSARNVYFPFD
VLNDTPIDVAKEMVKELEIMDWEAEEIADMIGGEISALVPNWTKQDMTDYNQENDDGFAP
PFLSFSSGSSSQASPSGFTAYRENEIASDYGCLQDVPDDMSSPSSIHSGTYSHTSYFCPE
DQEVNPGPSNPDQHLISRSNRHTRFCADDYQRPRQFKDRSQTLQCQVLTGSDRDSSSVIN
RRMAGHRLSRNRSLVDVHSQLLHLSLLEEVSKRRLSRTVGEVENIGFQAPFEISRNAPWI
GGSSFISSSRNKKGHRIQNRRN
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtacagaatacaagcagggtcggcagcagcggcaggggtcgagcctggatactgtgtt
gagaccgatcccaccggtcggtatgctcggtttgaagaaattctgggcaaaggggcgacc
aagacagtttacaaggcgatcgatgaggtcctgggaatggaggtggcgtggaaccaagtg
aagctgaatgattcgtttcggtctccggacgaatatcagcgtctgatctcggaggttcac
ctcctcagcaccctcaatcacgactccataatgaaattccacacttcatgggtcgacgtg
gatgggacggccttcaatttcatcaccgaaatgttcacttcaggcaccctcagaaattac
aggaagaaatacccacgattgcacatccgagccataaagaattgggctgttcaaatactt
cacggcctcgtgtatctgcacagccacgatccgccagtaatccacagagatctgaagtgt
gataacctctttgttaatggacatctgggacaagttaaaattggtgatcttggacttgca
gcgatccttcatggttctcgagcagctcatagcatcataggcactccagagtttatggca
ccagaactctacgacgagaattacaatgagctggtcgatgtctactcattcggcatgtgt
gtcttggaaatgcttacttgcgagtatccttacattgaatgcaccaatccggctcaaatt
tacaagaaagtcacgtcgggaaagttgccagaagcattctaccgtatcaaagactcaaaa
gctcggaaatttattggaaaatgcttagcaaacgtctcatgtagagtatcggcaagggag
ttgctacacgacccatttcttctaagtgatgaaggtgaccgcctcccaggattgaagttc
aaaatgccggagccattcttgaatgggagagatgtagataatctgcgtgcaagggataat
ccactcaggaccgacatgatgattacgggaaagttgaatcctgagggtgacaccattttt
ctgaaagttcagattgctgatagaaatggttcagcgagaaatgtctattttccttttgac
gttctaaatgacactccgattgatgtcgcaaaggaaatggtcaaggaactggagatcatg
gactgggaagcggaggagatagccgacatgattggtggagaaatctctgctttagtacct
aactggacgaaacaggacatgacagactacaatcaggaaaatgacgacggctttgctcca
ccttttctctcattctcttcaggttcgtcatcacaggcatcgccatcgggctttacggcc
tacagggaaaatgaaatcgcgtctgactacggttgtctccaggatgtgccagatgatatg
agctctccaagctccatacattctggcacatattcccacacaagttacttctgcccggaa
gatcaagaagtgaaccccggtccttcaaacccagatcaacaccttatcagcagaagcaac
agacatacgaggttttgcgccgacgactaccaaaggccaaggcaattcaaggataggagt
cagaccttgcaatgccaggtcctgacagggtcagatagagattcttcctccgtcattaac
cggaggatggccggccacagactttcacggaataggtctctggtagatgttcatagccag
ttacttcacctctcattgctggaggaggtgagcaagcggaggctgtccaggacagtcgga
gaagttgagaacatcgggtttcaggcaccctttgagatatcaagaaacgccccctggatt
ggcggatctagtttcatcagcagctcgaggaataaaaagggccacaggattcaaaacaga
agaaactga

DBGET integrated database retrieval system