KEGG   Eucalyptus grandis (rose gum): 104424650Help
Entry
104424650         CDS       T03547                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00030  Pentose phosphate pathway
egr00480  Glutathione metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Module
egr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
egr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    104424650
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104424650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egr04147]
    104424650
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     104424650
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     104424650
Exosome [BR:egr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   104424650
  Exosomal proteins of colorectal cancer cells
   104424650
  Exosomal proteins of bladder cancer cells
   104424650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 104424650
NCBI-ProteinID: XP_010035425
UniProt: A0A058ZZF4
Position
Unknown
AA seq 601 aa AA seqDB search
MAGHLSPCSSSSSSSSCSSSSSMSFSHPSSFELHRSLDKLLVLPRKTQGPSWVPRIRSRD
SSRKSFQLKSSNGHSLRSVSLHDGSSLAKELFKPNAQNSLSPVNSESAKSDLTYSITVVG
ASGDLAKKKIFPAIFALFYEDCLPKNFTVFGYARTKMTDEELRTMISKTLTCRIDKRENC
EDKMNQFLKRCFYHSGQYNSEENFRELDIKLKEKEAGKLANRLFYLSVPPNIFVDVVRCA
SIRASSTSGWTRVIVEKPFGRDSESSGELTRCLKQYLNEDQIFRIDHYLGKELVENLSVL
RFSNLVFEPLWCRNYIRNVQLIFSEDFGTEGRGGYFDHYGIIRDIMQNHLLQILALFAME
TPVSLDAEDIRNEKVKVLRSMRPLQLEDVIVGQYKGHSKGAKSLPGYTDDPTVSKDSLTP
TFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHVPGNLYKRNFGTDLDKATNE
LVLRVQPDEAIYLKINNKVPGLGMRLDRSDLNLLFKARYPREIPDAYERLLLDAIEGERR
LFIRSDELDAAWALFTPLLKELEEKKIVPELYPYGSRGPVGAHYLAAKHNVRWGDVGSED
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggccggacacttgagtccctgttcttcatcatcttcttcttcttcttgttcttcttct
tcctcaatgtcgttctcacacccttcttcattcgagctccacagaagtctggataagctt
cttgtcttgccgaggaaaacgcaggggccttcatgggttccgcggattcggtcaagagat
agctcgaggaagagtttccagctcaaatcctccaatgggcattcgctgcgctctgtttct
ttgcacgacggaagctctcttgcgaaagaactcttcaaacctaatgcgcagaatagtttg
tctcctgttaattcagaatcagcgaagtctgatttaacttatagcattaccgtcgttgga
gcttctggggaccttgcgaaaaagaagatttttccggccatcttcgcgctcttctatgag
gattgtctaccgaagaatttcacggtgtttggttacgcccggactaaaatgactgacgag
gagttgaggacgatgattagcaaaacactgacttgtagaatcgataagagggaaaattgt
gaagataaaatgaatcagttcctgaagagatgcttttaccattccggtcagtataattcg
gaggagaacttcagagaattggacattaagctaaaagagaaggaggctggaaaattggcc
aataggttattctacctatcagtaccaccaaatatattcgtggatgtggtgagatgcgct
agcattagggcttcttcgacaagtggatggaccagggtcattgttgaaaagccatttggc
cgtgactcagaatcatctggtgaactgactagatgtttgaagcaatacctgaatgaggat
caaatatttaggattgatcattacctggggaaggaacttgtcgagaacctgtcagttctc
cgattttccaatctggtttttgagccattatggtgtcggaactacattcgcaatgtgcag
ctgatattttccgaagattttggtacagaaggacgtggaggttatttcgaccattatggt
ataatacgagatataatgcaaaatcatctgctgcaaatattggccctctttgcaatggag
acacctgtcagcttagatgctgaagacattaggaatgagaaggtgaaagtgttaaggtca
atgagaccactacaactggaagatgtaattgtgggccaatacaagggccacagtaagggt
gcgaaatctcttcctgggtatacagatgatccaactgtgtcaaaggatagtctcacaccg
acatttgccgctgcagctcttttcataaacaatgccagatgggatggagttcctttcctt
atgaaagcgggcaaggctctccacaccaagagggcagagattagagttcaattcagacat
gtcccggggaacctgtacaaaagaaactttggaactgatttagataaggcaacaaatgag
ctggtacttcgtgtacaacctgatgaagctatatatttgaagatcaacaataaagttcct
ggtcttggaatgagattggatcgcagcgacctcaatctgctttttaaagcaaggtatcct
agggaaatacccgacgcatatgagaggttacttttggatgcaatagaaggagagcgtagg
ttattcataagaagcgatgagctcgatgctgcttgggcattattcactccattacttaag
gagcttgaggaaaagaagatagtccccgagctctacccttacggtagcagaggaccagtc
ggtgcgcattatcttgctgcaaagcataatgttcggtggggggatgtcggcagtgaggac
tcatga

DBGET integrated database retrieval system