KEGG   Eucalyptus grandis (rose gum): 104425209Help
Entry
104425209         CDS       T03547                                 

Definition
(RefSeq) alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00010  Glycolysis / Gluconeogenesis
egr00071  Fatty acid degradation
egr00350  Tyrosine metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104425209
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104425209
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104425209
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     104425209
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     104425209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N UDPG_MGDP_dh_N 2-Hacid_dh_C ADH_zinc_N_2 AlaDh_PNT_C IlvN
Motif
Other DBs
NCBI-GeneID: 104425209
NCBI-ProteinID: XP_010036132
UniProt: A0A059A0J1
Position
Unknown
AA seq 379 aa AA seqDB search
MATTQGQVITCKAAVAWEANKPLVIEDVQVAPPQAGEVRVKILFAALCHTDAYTWSGKDP
EGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAA
TGVGVMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGV
PTGLGAVWNTAKVESGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFDRAKDFG
VTEFVNPTEHDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAA
SGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVDKYLKKEIKVDEYITHNLTLGEIN
EAFHLLHGGDCLRCVLSMD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggctactacccagggccaggtcatcacctgcaaagccgccgtggcgtgggaggcgaac
aagccgctcgtgatcgaagacgtgcaggtggctcctccgcaggccggggaggtcagggtc
aagatcctcttcgccgcgctctgccacaccgatgcctacacttggagtggcaaggatcca
gagggtctgttcccttgcattcttggccatgaagctgcagggattgtagagagtgtcggt
gaaggtgttactgaagtccaaccaggggatcatgttatcccctgctatcaggcagaatgt
ggagaatgtaagttctgcaagtcagggaaaaccaacctctgtggcaaagttcgggcagca
actggtgttggagtgatgatgaatgaccggaagagccgtttctctgtgaatggaaagcct
atctatcatttcatgggaacttctacattcagccagtacacggtcgttcatgatgtcagt
gttgccaagatcgaccctaaagctcccttggagaaagtttgccttcttggctgtggtgtt
cccacaggactcggagcagtatggaacacagcaaaggtagaatcagggtctattgtcgct
gtcttcggcctgggaacagttggccttgctgttgctgagggtgcaaaagcagctggtgct
tcccgtataattggtatagatattgacagcaaaaagtttgatagagcaaaggattttgga
gtgactgagtttgtgaatccgactgagcatgacaagccaatccaacaggttcttgttgat
ctcaccgatggtggtgttgactacagtttcgaatgcattgggaatgtgtcagtaatgagg
gctgctttggaatgctgtcacaagggctgggggacgtcggtaatagttggcgtggcagca
tcagggcaggagatctccactcgtcctttccaattggtaaccggtcgtgtttggaaagga
acagcttttggtggtttcaagagccgctcccaagtgccgtggctggtcgacaaatatttg
aaaaaggaaatcaaggttgatgagtacattacacacaacttgactcttggggagatcaac
gaggctttccatcttctgcatggaggtgattgcctccgttgtgtgctttcaatggattga

DBGET integrated database retrieval system