KEGG   Eucalyptus grandis (rose gum): 104425219Help
Entry
104425219         CDS       T03547                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00350  Tyrosine metabolism
egr00360  Phenylalanine metabolism
egr00380  Tryptophan metabolism
egr00950  Isoquinoline alkaloid biosynthesis
egr00965  Betalain biosynthesis
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104425219
   00360 Phenylalanine metabolism
    104425219
   00380 Tryptophan metabolism
    104425219
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    104425219
   00950 Isoquinoline alkaloid biosynthesis
    104425219
   00965 Betalain biosynthesis
    104425219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egr04147]
    104425219
Enzymes [BR:egr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104425219
    4.1.1.105  L-tryptophan decarboxylase
     104425219
Exosome [BR:egr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104425219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104425219
NCBI-ProteinID: XP_010036146
UniProt: A0A059A1R4
Position
Unknown
AA seq 490 aa AA seqDB search
MEERLKPMDAEQLRESAHRMVDFIADYYKSIESFPVLSQVEPGYLRKLLPDSAPDHPESL
QQVLEDVQAKILPGVTHWQSPNYFAYYPSNSSIAGFMGEMLSAGLNIVGFSWITSPAATE
LEIIVLDWLAKLLNLPDDFLSTGPGGGVIQGTASEAVLVVLLAARDKFLSRIGKSSLDKL
VVYSSDQTHSALQKACQIGGIYPENCRVLKTDASTNYALSPDLLNEVISQDISTGLVPFL
LCATVGTTSSTAVDPLPALATVAKRNGMWFHIDAAYAGSACICPEYRPYIDGVEEADSFN
MNAHKWFLTNFDCSALWIKDRKALIQALSTNPEFLKNKASQANMVVDYRDWQIPLGRRFR
SLKLWMVLRLYGVQNLQQYIRNHIELARQFEDLVIQDPRFEVVTPRIFSLVCFRLLSPDN
DGDKGNKLNRDLLDTVNSTGKIFISHTVLSGTYILRFAVGAPLTEERHVNEAWKVLQDEA
SKLLATIQNN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaggttgaagccgatggatgcggagcaactgagggagagcgcgcacaggatg
gtcgatttcattgcggattactacaagtccatcgagagcttccccgtcctcagccaagtc
gagcctggctacttacgtaaacttcttccagattctgcacctgaccatcctgaatcattg
caacaagttcttgaagatgtacaggcaaaaatattacctggggtgactcattggcagagt
ccaaattattttgcatattatccttccaacagcagtattgcgggtttcatgggagagatg
ctcagtgctggcctcaacatagttggcttcagttggattacttctcctgctgcaacagaa
cttgaaattatagttctggattggctcgctaaacttctcaatctacctgatgacttcctt
tcgacaggaccgggtggtggagtaatacagggtactgcaagtgaagctgttctagtagtt
ctattggctgctcgcgataagttcttaagcagaatagggaaaagttctctcgataagctt
gttgtttattcttctgaccagacccactcggccttgcaaaaagcatgtcagataggaggt
atttatccagagaactgcagggttctaaaaacagatgcttctaccaattatgcgctctct
cccgatttactcaatgaagtgatttctcaggacatatccaccggtttagttcccttcctt
ttgtgtgctacagttggtaccacctcttccacagcagttgaccccttacctgcactagca
acagtagctaagagaaatggaatgtggttccatattgatgctgcatatgctggaagtgct
tgtatttgtcctgaatatcggccttacattgatggtgttgaagaagctgattcattcaac
atgaatgcacacaagtggtttctgacaaattttgattgctcagcactctggataaaagac
agaaaggcgttgattcaggccctttctaccaatccagagttcttaaagaacaaggcatca
caagcaaacatggttgtggactacagagactggcaaattcctcttgggcgtcgttttaga
tcactgaaactttggatggttttacggctgtatggtgtacaaaatcttcagcagtacatc
agaaaccacattgagctggccagacagtttgaagatcttgtcatccaagaccctagattt
gaggttgttacccctcggatattttcattggtctgtttccgtcttctctctcctgacaat
gatggagataaaggaaacaaattgaaccgtgatctattagatacagtaaactctactggg
aaaatcttcatttctcacactgttctctcgggtacatacatcttacgctttgcagttggg
gctccattgacagaagagagacatgttaatgaagcatggaaggttctgcaggacgaggca
tctaagctgctggctactattcaaaataactaa

DBGET integrated database retrieval system