KEGG   Eucalyptus grandis (rose gum): 104426258Help
Entry
104426258         CDS       T03547                                 

Definition
(RefSeq) uncharacterized protein LOC104426258
  KO
K06195  ApaG protein
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    104426258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 104426258
NCBI-ProteinID: XP_010037554
UniProt: A0A059A614
Position
Unknown
AA seq 296 aa AA seqDB search
MHSLSLKAFGDVNAGARRCFPSEAGPRREWLNCSRELPRRNCRIVACSPEGNGGGGGGGG
GAGGGGGGEGKSSSLSSSSSGRSFPTRSQTYALLKQQMEVAAKSEDYKEAARIRDSLKLF
EEEEPVLHLRRLIKDAVTDERFEDAAKYRDELKEIAPHSLLKCSSDATTLGIRVQVRSVY
IEGRSQPSKRQYFFAYRIRITNNSDRPVQLLRRHWIITDGNGKVDNLWGIGVIGEQPVML
PRTSFEYSSACPLCTPSGRMEGDFEMKHVDKVNSPTFNVAIAPFSLSTLGDDSDAF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcattccctgagcctgaaggccttcggcgacgtcaatgccggggccaggaggtgcttc
ccgtccgaggcgggcccgaggagggagtggctcaattgcagcagagagcttccgaggagg
aattgccggatcgtcgcttgttcgccggaggggaacggcggcggcggcggcggcggcggt
ggtgcgggaggaggagggggcggggagggcaagagttcgagcctgagctccagctccagc
ggccgctcgttcccgacgcggagtcagacctacgcgctgctgaagcagcagatggaggtc
gccgccaagtccgaggattataaggaggctgctcgaattcgcgattcgttgaagttgttc
gaggaagaggagccggttctgcacctgcgaaggttaattaaggacgcggtcactgatgag
aggttcgaggatgcggctaaatatcgtgacgagctgaaagaaattgcaccccattcactc
ttgaaatgttcaagcgatgcaacaaccctgggtatcagggttcaagtcaggagtgtgtac
atcgaggggcggagtcagccttccaaaaggcagtacttttttgcttataggatcagaatt
accaacaattcagatcgaccagttcaacttcttagaagacactggatcattaccgatggc
aatggcaaagttgacaacttatggggaattggagttataggcgaacaacctgttatgctt
ccccggactagttttgagtactcctctgcatgcccgctttgcacgcccagcggaagaatg
gaaggcgacttcgagatgaagcatgtcgacaaggtaaattcaccgacgttcaatgtggct
atcgcaccattctcgctctccactttgggggacgactccgatgctttctga

DBGET integrated database retrieval system