KEGG   Eucalyptus grandis (rose gum): 104426301Help
Entry
104426301         CDS       T03547                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00051  Fructose and mannose metabolism
egr00520  Amino sugar and nucleotide sugar metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Module
egr_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    104426301
   00520 Amino sugar and nucleotide sugar metabolism
    104426301
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     104426301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase DUF4954 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 104426301
NCBI-ProteinID: XP_010037602
UniProt: A0A059A7K4
Position
Unknown
AA seq 415 aa AA seqDB search
MGSAEERVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLAGQPMVHHPISACKRIPNLAQIY
LVGFYEEREFALYVSSISNELKVPVRYLKEDKPHGSAGGLYNFRDLIMEDSPSHIFLLNC
DVCCSFPLPEMLEAHISYGAMGTLLVIKVSAESASQFGELIADPSTKELLHYTEKPETFV
SDLINCGVYIFTPEIFSAIRNVSTQRKDRANLKRVSSFEALQPATRNLPTDFMRLDQDIL
SPLAGKRQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRSTSPHLLASGDGTKGATIIGD
VYIHPSAKVHPTAKIGPNVSISANARVGAGARLMNCIILDDVEIKENAVVTHSIIGWKSS
IGKWSRAQGGGDYNAKLGITILGEAVTVEDEVVVINSIVLPNKTMNISVQEEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgccgaggagagagtggtcgccgtcatcatggtcggcggccccaccaaaggt
actcgatttcggccgctgtcgctgaatattccgaagccgcttttccctttagcggggcag
cccatggttcaccatccaatctctgcttgtaaaagaattccaaatctagctcagatctat
ctcgtgggtttctatgaggagcgtgaattcgcgctgtacgtgtcctcgatttcgaacgaa
cttaaggtccccgtcagatatctaaaggaagacaagccacatggttctgctggtggtctg
tataacttcagagatctgataatggaagacagcccgtctcatatcttcttgctgaactgc
gatgtttgctgcagtttcccattgccagaaatgcttgaggctcatataagttacggtgcg
atgggaacccttctcgtgattaaggtctctgcagaatcagcaagccagtttggtgaactt
atagctgatccaagtaccaaagagttgttgcattacacagagaaaccagagacatttgtg
agtgacctgataaattgtggtgtttacatatttacaccagaaatattcagtgccatccgc
aatgtgtccactcaacggaaagacagagccaatttgaaacgtgtctccagctttgaggcc
ttacaaccagcgacaagaaatctccccacagatttcatgcgattggatcaagatatctta
tcacctctagctggaaaaaggcagctatatacatatgaaaccatggacttctgggaacaa
ataaagactccaggaatgtccttaaaatgttcaggtttgtatcttgcacagtttcgctct
acctctccccatcttttggcaagtggagatggtacaaagggtgctaccattattggtgat
gtctatattcatccatcggcgaaagtgcacccaactgccaagattggacctaatgtctcc
atatcagctaacgcacgtgtaggagcaggtgccaggctcatgaattgtatcatcctcgat
gatgtcgagatcaaggaaaatgcagtggttactcattcaattattgggtggaaatcttcc
attgggaaatggtcacgtgcccagggtggaggagactacaatgcgaagcttggaataaca
atcctcggtgaagctgtgaccgttgaagatgaggtggtggtaatcaacagcatcgtcctt
cccaacaagactatgaatatcagtgttcaggaggagataattttatga

DBGET integrated database retrieval system