KEGG   Eucalyptus grandis (rose gum): 104432361Help
Entry
104432361         CDS       T03547                                 

Definition
(RefSeq) probable protein S-acyltransferase 17 isoform X1
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egr04131]
    104432361
Enzymes [BR:egr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104432361
Membrane trafficking [BR:egr04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    104432361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC IGFBP
Motif
Other DBs
NCBI-GeneID: 104432361
NCBI-ProteinID: XP_010043142
UniProt: A0A059D3Y6
Position
Unknown
AA seq 395 aa AA seqDB search
MAVQWVLVLHGLATLVVVVSFLCGQWPIFRRTPIAYIHHFLTVGAYDYLLRCVGVLFGVR
GTNAILEVERFCCDRPNPILQIIYLAIVGGTYFIVAKSCFSYIPGYYLSGIHRHMSLLAV
GIGVLLFVLTSFSDPGTVKDDNVSQYLTAYPYDDIIYSEKECPTCKIPKPARSKHCSICD
RCVARFDHHCGWMNNCIGERNTRYFMAFLLWHFLLCVYGAVAIGLVLAGQLKESRVIYVL
TVYYGIENSFRSLAPHVLQWFVGSYDTQILLMVFLAIVALLLAGFFGYHASLCFTNTTTN
ETFKWQEYINWQRKLNEARASTAALRASLNGMSSEVSPRKSKWRAFFRRSPLEDAKLVVK
ENKYDKGLIQNINEIIVPLSSRSSFSQKKPKVRRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcagtgggttctggtgctgcacgggctggcgacgctggtggtggtcgtctcg
ttcctgtgcggccagtggcccatcttccgccgcacccccatcgcctacatccaccacttc
ctcaccgtcggtgcctacgactacctcctgaggtgtgttggggtgctgtttggagtgaga
ggcacgaatgcgattctggaggtggagcggttctgctgcgatcgccccaaccctattttg
cagataatatacttggcaatagttggaggaacttatttcattgtggcaaaatcatgcttc
agctatattcctggatattatttaagtggaattcacaggcacatgagcttgttggcagtt
ggcattggtgtccttctctttgtattgactagcttttctgatccagggactgtaaaggat
gacaatgtctctcaatatcttactgcttacccctatgatgatattatttactctgagaaa
gaatgtccaacttgcaaaattccaaaacctgccaggtccaagcattgcagcatttgtgat
cgctgtgttgcaagatttgaccatcattgtgggtggatgaataattgtataggggagaga
aatactcgatacttcatggcttttcttttatggcattttctactgtgtgtatatggggct
gttgccattggattggttcttgctggacagctgaaggaatcaagagtgatctatgtacta
actgtgtattatggcatagaaaattcttttcgtagtttagctcctcatgtgcttcagtgg
tttgttggatcctatgatactcaaatattgcttatggtgttccttgcaatagtcgcgctg
ctactggcaggtttctttggctaccatgccagcctctgcttcacaaacactaccactaat
gagactttcaagtggcaagagtacataaattggcagaggaagctgaatgaagcaagagcg
agcaccgcggcactccgagccagtcttaatgggatgagcagtgaggtgtcgcctcgcaaa
agcaaatggagggctttctttagaagatcacccttggaagatgctaagcttgttgttaag
gaaaacaagtatgataaaggactcattcaaaatatcaacgagatcattgttcctttatca
tcgagatcgtcattttcacagaagaaacctaaagtccgtcgagaatga

DBGET integrated database retrieval system