KEGG   Eucalyptus grandis (rose gum): 104433809Help
Entry
104433809         CDS       T03547                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2
Organism
egr  Eucalyptus grandis (rose gum)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop PIP49_C PAN_2 APH
Motif
Other DBs
NCBI-GeneID: 104433809
NCBI-ProteinID: XP_010044982
Position
Unknown
AA seq 862 aa AA seqDB search
MQSIFQALAGRRRWKETTERTRFCVFQLDFYPFFCPGSLPSSCINLPIHRFVIQPESNRA
TMASPASISHLLLLFLLLLLLPYLAISQSNITPGKSLVAGDKESPPWLSPSGDFALGFSQ
PDDKSDSFVVSIWYAKIPEKTIVWCASDTSKRPVIAPRGSKLVVTADRGLVLNDTGGGIP
WNSDPIVGAVAYGYMNDTGNFVLKNRDSETLWESFDYPTDTILPEQILPNNGILSSRQSA
TNFSQGRFQLRLQNGNLLFTTINLPSSHVNEPYFTFTLPSVSVTGISFDDSGFLNSLHDN
GQTSPLKTVSRGSPRDNYLRATLESDGVFIQYSRPKTGGNWMVDWPMPENICKTGQNIGS
GICGFNRICRLDVNDRPVCECPLGFSVLDEKDEYRGCVQNYSQSCGEAQSSGPDAFVLEE
ITSIDWPTSDYNLLQPFTEAECKDSCLRDCMCAVAIFRDNDMCWKKKLPLSNGRIDTSLN
AKAFIKRRKDGFPLQTPSPPGPNDDKKDILILAGSVLLGSSVFVNFILIAASCLGVFMIY
QNKLKKFFEDESGMDINIRSFTYKELEDATGGFKEELGRGSFGIVYKGVIAIGDSRNVVA
VKKLDRSFQESEKEFKTEVIVIGQTHHKNLVRLIGYCNEGQNRLLVYEFLSNGSLASFLF
EDLKPSWEQRAQIALGIGRGLLYLHEECKTQIIHCDIKPQNILLDEYYNARISDFGLAKL
LISQTHTHTAIRGTRGYVAPEWFRNMPITVKVDVYSFGVLLLETICCRRSIDIEAGNEER
VILADWAYDCYREGALEELVEKDEAALNDMKKLERFVRVAIWCIQEDPALRPTMKKVMLM
LEGIIQVSAPPSPFAFSTISTV
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtattttccaagctcttgctggtcgaagaaggtggaaggaaacgacggaaaga
acgcgtttttgcgtatttcagttggacttttacccattcttttgtcccggttcactccct
tcctcatgtataaacctgccaattcatcgtttcgttattcaacccgaaagcaacagagca
acaatggcttctcctgcttctattagccatctgctcctgctgttccttcttcttcttctt
ctgccatatcttgccatttcacagtccaatataaccccgggcaagtctctggttgcgggg
gataaggagtctcctccgtggctctctccttccggagatttcgccttggggttcagccaa
cccgacgataagagcgacagcttcgtagtctccatatggtatgccaagattcctgagaaa
accatagtctggtgtgccagtgatactagcaaacgacctgtcatcgcaccccgaggatca
aaactggtggtaactgctgatcgcgggctcgttctgaatgatacaggaggcggaattcca
tggaattccgatcccatagttggtgcggtcgcttatggatacatgaacgatactggaaat
tttgttctcaagaacagagactctgagactctttgggagagcttcgactaccccaccgac
accatcctgcccgaacagatcttaccgaataatgggattctgtcttcaagacaatcggca
accaacttctctcagggaaggtttcagctccgtttgcagaatgggaacctcctgtttacg
acaataaacttgccttccagtcacgtcaatgaaccgtacttcacgttcactctgccttct
gtttctgttacggggattagttttgatgactccggcttcttgaattcccttcatgacaac
ggccaaacgtcgcctctcaagacagtttcgcggggatcgcccagggacaactatttgaga
gccactttggagtcagacggggtcttcatccagtactctcgccccaagactgggggaaat
tggatggttgactggccgatgccggaaaatatatgcaaaactggtcagaatatagggagt
ggcatttgtggtttcaacaggatatgcaggctcgacgtgaatgaccggccagtctgcgag
tgccctctgggattttctgtgcttgacgagaaagatgagtatagaggttgtgtacaaaat
tattcacaaagttgtggagaagcgcagagttcaggaccggatgcgtttgtacttgaagaa
attactagtatcgattggccaacttctgattacaatctcttgcaacctttcacagaggcc
gagtgtaaagattcctgcctccgcgactgcatgtgtgctgtcgccatctttagagataat
gacatgtgttggaagaagaagctgcctctctccaatggcaggatcgacacaagcctcaat
gcaaaggccttcatcaagagaagaaaggatggctttcctcttcagacccctagtcctccg
ggaccaaatgatgataagaaggatattttgattcttgccgggtcagttcttttaggcagc
tcagtgtttgtcaacttcatactgattgctgcatcatgcctcggcgttttcatgatatac
caaaacaaattaaagaagttcttcgaagatgaaagtggcatggacataaatatacgcagc
ttcacatacaaagagcttgaagacgccaccggtggcttcaaggaggaacttgggaggggg
tcgtttggcatagtttacaaaggggtcattgcaattggagactccagaaatgttgtagca
gttaagaagttggataggtcttttcaagagagtgagaaggaattcaaaactgaagttata
gtgattggacaaacccatcacaagaatctggttaggttgatcgggtactgcaacgaaggg
caaaatcgcttgctggtttacgagttcttgagcaatggatcgttagcgagcttcctgttt
gaggatctgaaacccagttgggaacagagggcccaaattgccttgggaatcggaagagga
ctcctctacttgcatgaagaatgcaaaacccagatcatccattgcgacataaagcctcaa
aacatccttctcgacgaatattacaatgccaggatttcagatttcggactagccaagctc
ttgatcagccaaacccacactcacactgcaataaggggaacgagaggatatgttgccccc
gaatggttccggaacatgccgatcactgtgaaggtcgatgtgtacagtttcggtgtcctg
ctgctagagaccatttgctgtaggagaagcattgacatagaagccggcaatgaagagaga
gtgatcttagctgattgggcttatgactgctatcgagaaggtgcgctagaagaacttgtt
gaaaaagacgaggcagccctgaatgacatgaagaagctcgagcgatttgtgagggttgcc
atctggtgcatccaggaagatccagccttaagaccaaccatgaagaaggtaatgctaatg
cttgaagggataattcaggtgtctgcaccaccgtcccccttcgcatttagtaccataagt
acagtgtaa

DBGET integrated database retrieval system