KEGG   Eucalyptus grandis (rose gum): 104435956Help
Entry
104435956         CDS       T03547                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase 2
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     104435956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 104435956
NCBI-ProteinID: XP_010046982
UniProt: A0A059CKJ6
Position
Unknown
AA seq 683 aa AA seqDB search
MDRPNASSEYVAELASLLFENKVLAILTTIIALLIGWVAFRWSRSGSQKPRSFEPPKPLI
VKETEPEADDGKKKVTIFFGTQTGTAEGFAKAMAEEAKARYEKAVFRVVDLDDYAADDEE
YEEKLKKETLVIFFLATYGDGEPTDNAARFYKWFTEGNERGQWLQNLQYGVFGLGNRQYE
HFNKVAKVVDDALVEQGAKRLAPVGLGDDDQCIEDDFSAWRELVWPELDNLLRDEDDATA
ASTPYTAAVLEYRVEYHDPMDTAALEKSLSIANGNVVIDAQHPRRANVASRRELHTHESD
RSCIHLEFDIAGTGHAYETGDHVGVYCENLTETVDEALNLLGVPPETYFSIHTDKEDGTP
LSGGSFPPPFPPCTLRTALSKYADLLNSPKKSALLALAAHASDPNEADRLRYLASPAGKD
EYSQWVVASQRSLLEVMAEFPSAKPPLGVFFAGVAPRLQPRFYSISSSPRMVPSRIHVTC
ALVYGKTPTGRTHKGVCSTWMKNAVPLDESDQCSWAPIFVRQSNFKLPTDSKVPIIMIGP
GTGFAPFRGFLQERLALKEAGVELGPSILFFGCRNRRMDFIYEDELNNFVNAGALSELLV
AFSREGPTKEYVQHKMLEKASDIWKIISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSL
DSSKTESLVKNLQMNGRYLRDVW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccccaatgcctcgtcggagtacgtcgccgagctggcctccctcctgttcgag
aacaaggtgctggcgattttgaccaccatcatcgcgctcctgatcgggtgggtggcgttc
cgctggagccgatccggcagccagaagccgagatccttcgagccacccaagcccctaatc
gtcaaggagaccgagcccgaggccgacgacggtaaaaagaaagtcaccatcttttttggt
acccagaccggtacggccgaaggtttcgctaaggcaatggctgaagaagcaaaagctaga
tatgagaaggcggtgtttagagttgttgacttggatgattatgctgctgatgatgaggag
tatgaggaaaagctgaaaaaggagactttggtcattttctttctggccacatacggagat
ggcgagccaactgataatgcagcaaggttctataagtggtttacagagggaaatgagaga
ggacaatggcttcaaaacctgcaatatggagtgtttggcctcggcaacaggcagtatgag
cattttaacaaggttgcaaaggtggttgatgatgcccttgttgagcaaggtgccaagcgt
ctcgcgccagtgggtcttggggatgatgatcagtgcattgaagatgacttcagtgcatgg
cgggagttggtgtggccggagctggataatttgctacgggatgaagatgatgctacagct
gcttctactccttatactgctgccgtattggaatatagggtggagtatcatgaccctatg
gatacagcggctctggagaaaagcttaagcattgccaatggtaatgtcgttattgatgct
caacacccacgcagggctaatgttgcctcaaggagagaactgcacactcatgaatctgat
cgatcctgcattcatttggaatttgacattgctgggactggacatgcatatgagactggg
gatcatgttggtgtttactgcgagaatctaacggaaactgttgatgaagcattgaattta
ttgggcgtgccaccagagacttatttctccatccacaccgataaggaggatggtacacca
ttaagtggtggctcattccctcctccattcccaccctgtacattgagaacagccttatct
aaatatgcagatctcttgaattcaccgaaaaagtctgctttacttgcgttagcagctcat
gcttctgatccaaatgaggctgatcgactgagatatcttgcatcacctgctggaaaggat
gaatattcacagtgggtagttgccagccaaagaagcctccttgaagttatggccgagttc
ccttctgcaaaaccgcctcttggtgtcttctttgcaggagttgctcctcggctgcaaccc
agattttactcaatctcctcctctcctaggatggtgccctctagaattcatgttacctgt
gcactagtttatggaaaaacaccaacaggaaggactcacaaaggagtttgctcaacttgg
atgaagaatgctgtgccattggatgagagtgatcaatgcagttgggctcctatttttgtg
aggcaatcaaacttcaaacttcctacggattctaaagtacccattatcatgattggacca
ggcactggatttgcaccttttaggggtttcctacaggaaagattagctctgaaagaagct
ggagtggaacttggaccatctatactatttttcgggtgcagaaaccgccgaatggatttc
atttatgaagacgaactgaacaactttgttaatgctggcgcactgtctgagcttcttgta
gccttctcgcgtgagggaccaaccaaggaatacgtgcaacacaaaatgttggagaaggct
tcagatatttggaaaataatctctgagggaggctacgtatatgtttgtggtgatgccaaa
gggatggctagggacgtccacagaactttgcacacaattgttcaagagcagggatctctt
gacagctcaaaaaccgagagtctggtgaaaaatttgcaaatgaacggtcggtatctgcgt
gatgtgtggtga

DBGET integrated database retrieval system