KEGG   Eucalyptus grandis (rose gum): 104437852Help
Entry
104437852         CDS       T03547                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00052  Galactose metabolism
egr00500  Starch and sucrose metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104437852
   00500 Starch and sucrose metabolism
    104437852
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104437852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104437852
NCBI-ProteinID: XP_010049203
Position
Un
AA seq 575 aa AA seqDB search
MKLFLIYVVGLFCAGVGYGAEVGDFDHVQRNLQSDSTDQPYRTGYHFQPPRNWMNDPNGP
IYHNGVYHLFYQYNPYGAVWGNIVWAHSVSYDLINWVNLEDAIYPTGPFDVNGCWSGSAT
LLPGGKPAIFYTGSDVKNRQVQNLAMPKNTSDPLLREWVKSTHNPLITPPYGTDPNFFRD
PTTAWQGEDKAWRLLVGSQIKGRGTAILYKSEDFISWSRIGSLFNSLAETDMWECPDFYP
VGINSMNAVETSEQGEWTKHVLKASFNSHDYYILGNYDKKTDRFSVENDFTVSSSGLRYD
YGKFYASKTFYDSAKERRILWGWINESDSKSSDIKKGWSGLQSIPRNVLLSKSGKQLVQW
PIKETEKLRAKEVTALSKDLKGGSAVEVLGITAAQADIEVSFETTDLAKAETIDHNSVDP
QLLCSSKTASVRGKLGPFGLLALASEDLKEQTAIYFHVLKKNGKFVVLMCSDQSRSSLMG
GLDKTTYGGFVDIDPRHEKISLRSLIDHSIVESFSGKGKTCITARVYPSLAIGNKAHLYV
FNNGTVGVKISRLSAWSMKNARIAPISKRRKRKTS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttcctgatatatgttgtaggattattctgtgcaggagttggatatggagct
gaagttggagactttgatcatgttcaaagaaatcttcaatccgattctacagatcagcct
tacagaactggataccacttccaacctccgagaaactggatgaacgatccaaatggacca
atctatcacaatggagtctaccatctgttctaccagtataatccatacggtgctgtgtgg
ggtaacatagtgtgggctcattcagtatcttacgatctgatcaactgggtgaacctggag
gatgcaatttatccgacagggccttttgatgttaatggatgctggtctggttcggcaacc
cttcttcctgggggcaaacctgccatattttacacagggagcgacgtgaagaaccgtcag
gtccaaaacttggcaatgcccaaaaacacatccgatccattgctccgcgagtgggtcaaa
tcaactcataacccgttaatcactccaccatatggaactgatcctaatttcttcagagac
ccaacaaccgcctggcaaggcgaggacaaggcatggcgccttctagttggaagccagatt
aaaggtcgagggaccgcgattctttacaaaagcgaagactttattagctggagcaggata
gggagcctgtttaattcgttggccgagaccgacatgtgggaatgcccggatttttatcct
gttggtattaatagcatgaatgcggtggaaacctcagagcaaggggagtggaccaagcat
gtgctcaaggcaagtttcaactctcacgactattacatactcgggaactacgataagaaa
acagacagattctctgttgagaatgacttcaccgtttcaagttcgggcttgcggtatgac
tatgggaaattctatgcttcgaagacgttctatgacagcgcaaaagagaggcgtattctg
tggggctggataaatgagtccgatagcaagtcatctgacattaagaagggatggtcagga
cttcagtcgattcctcggaacgtccttcttagtaaatcgggaaagcaattagtgcaatgg
cctattaaagaaacagagaaactccgtgctaaggaggtgactgctttgagtaaggatctc
aagggtggatcggcagtcgaagttttaggcattacagctgcgcaggctgatatcgaagtt
tcattcgagaccaccgatttagccaaggctgagaccatagatcacaattcggtcgatccg
caactgctctgttctagcaaaacagcatctgttagaggcaaactcggcccgtttggtttg
ttggctctagcttctgaggacctgaaagaacaaacagcaatctattttcatgttctgaag
aagaatggaaaattcgttgtgctgatgtgcagcgaccagagcaggtcgtcattaatggga
ggccttgacaagaccacttacggaggatttgttgacatagacccccgtcatgagaaaata
tctctcagaagcttgattgatcactcgattgtcgagagcttcagtggcaaagggaagact
tgcatcactgcgagggtttatccgagcttggccatcggcaataaagctcacctatatgtg
ttcaacaatggaacagtcggtgtcaagatctcaagactcagtgcctggagcatgaaaaat
gctcggattgctccaatcagcaaaagaagaaagcgaaaaaccagttaa

DBGET integrated database retrieval system