KEGG   Eucalyptus grandis (rose gum): 104438577Help
Entry
104438577         CDS       T03547                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:egr01003]
    104438577
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egr02000]
    104438577
Enzymes [BR:egr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     104438577
Glycosyltransferases [BR:egr01003]
 Polysaccharide
  Structural polysaccharide
   104438577
Transporters [BR:egr02000]
 Other Transporters
  Others
   104438577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 104438577
NCBI-ProteinID: XP_010050059
UniProt: A0A059DFA7
Position
Unknown
AA seq 533 aa AA seqDB search
MDRLSATGLLPDTFGGARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERV
YMAVVILLVKLFGRKPEKRYRWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAAC
GLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGM
KRSYVKQCDYVAILDADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQE
MSLDYHFTVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKG
WKFVYLGSLKVKNELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRNKKVTLWKKVHVIY
SFFLVRKIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLV
VFWILFENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFRFGDR
LHVLELGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaccggctctctgcaactggtctccttcccgacacgttcggaggagcaagagacgac
atctccatgcaactttcgctgatttgggctcagatcaaggcgccgttgctcgtcccgttg
ctccgggtggcggtgttcctttgcctggccatgtcgctgatgctgttcctcgagagggtg
tacatggccgtcgtgatcctcctggtgaagctcttcggccggaagccggagaagcggtac
aggtgggagcccataaaggacgacgtcgagctgggcaactcggcctaccccatggtcctg
gttcaaatcccaatgtacaacgagcgagaggtttatcagctctcgatcggagccgcatgc
ggtctctcgtggccgtccgaccgcatcatcattcaagtcctcgacgattccaccgacccg
acgatcaaggacctggtggagctggagtgccagaggtgggcgagcaaagggatcaacatc
aggtacgagatccgggacaaccggaacgggtacaaggccggggcgctcaaggagggcatg
aagcggagctacgtgaagcagtgcgactacgtcgccatcctcgacgccgacttccagccc
gaacccgacttcctctggcggaccatccctttcctcgtccacaaccccgaggtcgccctc
gtccaggcccgttggaaattcgtgaatgcggacgagtgcttgatgacgagaatgcaagag
atgtccctggattaccatttcaccgtcgagcaagaagtcgggtcctccacccacgccttt
ttcggattcaacggcacggcgggtgtatggcgcatttctgccctgaacgaggccggaggt
tggaaggaccggaccaccgtggaagacatggacttagcagtcagggcgagcctcaaaggc
tggaagttcgtgtacctcgggagtctcaaggtgaaaaatgagctgccaagtaccttcaag
gcttaccgctttcagcaacaccgttggtcgtgcggtcccgcgaatcttttcaggaagatg
gccatggaaatcattcgaaacaagaaggtcactctgtggaaaaaggtgcatgtgatttac
agcttctttctggttagaaagatcgtagcgcacatcgtcaccttcatcttctactgcgtc
gtgttgccggcgaccgtttttgtgcctgaagtcaccgttcccaagtggggtgcagtttat
attccttccattattactgtcctcaatgccgtcggtactcctaggtcgctccatttggtg
gttttctggatcctgttcgagaatgtcatgtcgttccaccgaacaaaagcaaccttcatc
gggcttttagaagccgggagggtaaacgagtggatcgtcactgagaaactcggggatgcg
ctcaaggttaaagcttctaacaaagtgcccaaaaagcctaaattcagattcggagatagg
ttgcatgtgctagagctcggcgtcggagcctacctcttcttttgcggctgttacgacatc
gccttcgggagaaatcactacttcatgtaccttttcgcgcaagccatcgccttcttcatt
atgggatttgggtacatcggcaccttcgttcctaattcatag

DBGET integrated database retrieval system