KEGG   Eucalyptus grandis (rose gum): 104439699Help
Entry
104439699         CDS       T03547                                 

Definition
(RefSeq) (-)-germacrene D synthase
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104439699
Enzymes [BR:egr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     104439699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 104439699
NCBI-ProteinID: XP_010051026
UniProt: A0A059CRJ8
Position
Unknown
AA seq 566 aa AA seqDB search
MSLQILAIPSSSPAQETSRVVERRLANFHPSIWGDYFLKYASDSNSMSSAIADDRIEGLK
GELRKMLAGAMDKPSQKLNLIDQIQRLGIAYHFEIEIYQQLEQIHKSYYELHDGDNDNDL
HTIALLFRLLRQQGYAISCEIFNKFKDINGNFSESLIVDVQGLLSLFEACHMRFHGDDVL
NDALAFAMTHLEAIDKGKASPNLKRQVRHALKQPIHKGIPRLEARHYISLYQEEPLHNEV
LLSLTKLDFNLLQEQHQKELGNLTRWWKDLDVERKFPFARDRLVEMYLWMSGVYFEPEYE
ATRELLTKVFSIVTIIDDIYDVYGTLEELELFTEAIERWDAEVKDGLPEYMQACYKIVLD
FYDEIGYEVTRKGRSDYLFYAKEAMKNQVRAYFTEAKWFHQNHIPTMEEYKSIALPTTAI
ELLLVMLLLGMGDTVTKDVFDWLLYSDPKMVNALKVVCRLMDDIAGHKFEQERGHGPSSM
ECFMKQYRVTEEEAKEELHKQVANAWKDINEGLCCSTNVPRQLLVRILNFTRVVHVVYKD
EIDLYTHAGTKLKEHVTNLYINPLPM
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcagattttagcaatcccatcttcttctcctgctcaagaaacaagccgcgtc
gttgaacgccgtttagcaaattttcatccaagcatatggggggattattttctcaaatat
gcttctgactccaactcgatgagttctgctatagctgacgatcgaatcgagggattgaaa
ggagaattgaggaagatgttggcaggtgctatggataagccttcgcagaagttgaacttg
atcgatcaaatccaacgcttaggaatagcctaccattttgaaattgagatatatcagcag
ttggagcaaattcacaaaagctattatgaattgcatgatggtgataacgacaacgaccta
cacacgattgctcttctctttcgattgttgcgacaacaaggttatgcaatttcatgtgaa
atctttaacaagttcaaggacatcaatgggaatttcagcgaatcactcattgttgatgtg
caaggactactaagtctatttgaagcttgtcatatgaggtttcatggcgatgatgttttg
aatgatgcacttgcttttgcaatgactcacctcgaggcaattgataaaggaaaagcaagc
cctaatcttaaaagacaagtgaggcatgctctaaaacaaccaatccacaagggaatacca
aggctagaggcaaggcactacatttcactctaccaagaggagcctttgcataatgaagta
ctgctatccttaactaaactcgatttcaacttattgcaagagcaacaccagaaggaactc
ggtaaccttacaaggtggtggaaggatttagatgtagaaaggaagttcccatttgctaga
gatagacttgtggagatgtatctttggatgtcgggagtttatttcgagccagagtatgaa
gccacaagggaactactaaccaaagtgtttagcattgttaccattatcgatgacatctat
gatgtctatggcacattggaggaactagaacttttcacggaagcaattgaaaggtgggat
gctgaagtcaaagatggattaccagagtacatgcaagcatgttataagatagttcttgat
ttttatgatgaaattggctatgaggtgactagaaaagggcgatcggactaccttttctat
gcaaaagaagcgatgaaaaaccaagtgagagcgtacttcactgaagccaaatggttccat
caaaaccacataccgacgatggaggagtacaagtccattgccttaccaaccactgctatt
gaattgctgttggtgatgttgttgttaggaatgggagatactgtaacaaaagatgttttt
gactggctattgtacagcgaccccaagatggtgaatgctttgaaagtagtctgtcggctt
atggatgacatcgctggacacaagtttgagcaagagagaggtcatgggccatcttcaatg
gagtgtttcatgaaacaatatagagttacagaggaagaggctaaggaggaactccataaa
caagtggccaatgcatggaaggacattaatgaagggttgtgctgctccaccaatgtccct
aggcaactccttgtgcgaattctcaattttacacgagttgtgcatgtggtgtataaagat
gagatagatctctacactcatgctggaaccaagttaaaagagcacgttactaatctatac
atcaatccattgccaatgtga

DBGET integrated database retrieval system