KEGG   Eucalyptus grandis (rose gum): 104441312Help
Entry
104441312         CDS       T03547                                 

Definition
(RefSeq) glutathione S-transferase zeta class
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00350  Tyrosine metabolism
egr01100  Metabolic pathways
Module
egr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104441312
Enzymes [BR:egr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104441312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 104441312
NCBI-ProteinID: XP_010052710
UniProt: A0A059CET6
Position
Unknown
AA seq 235 aa AA seqDB search
MAAAAATGGGAATGAGSPPAKLKLFSYWRSSCSFRVRFALNLKGLEYEYVPVNLLKGEQF
GAEFSKINPIHYVPALADGDFVLADSFAILMYLEEKYPHHRPLLPSDLEKRAINYQAANI
VSASIQPLQNIYVLKFLEEKVSPSEPLSWVQYHIGRGFSALEKVLADHAGKYATGDEVCL
ADVFLAPQIYAAVKRFNVDMSQFPILSKLHEAYSEIPAFQDAMPENQPDAPQPQA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgacgggcggtggtgcggcgaccggggcgggctcgccgccggcg
aagctgaagctgttcagctactggaggagctcctgctcgttccgcgtccgtttcgccctc
aacttgaaagggctggagtacgagtacgtgcctgtgaatttgctgaagggggagcaattc
ggtgctgagttctcaaagattaatccaattcattatgtgcctgcgttggctgatggggac
tttgtactggcagactcatttgctatcctaatgtatttagaagagaaatatcctcatcac
cgcccacttttgcccagtgatctggagaaaagggcaatcaactatcaggctgcaaatatt
gtttctgcaagcatacaacctcttcagaatatctatgttctgaaatttcttgaggagaaa
gttagtcccagtgagccgctttcttgggttcaatatcacattggaaggggcttttcagca
cttgagaaggtgttagcagaccatgctggaaaatatgcaacgggagatgaagtttgcctg
gccgatgttttcctggcaccccagatttatgcggcagtcaagaggttcaatgtcgacatg
agtcaatttcctatcttgtcaaagttgcacgaggcatacagtgagatacctgcttttcaa
gatgccatgccggaaaaccagccagatgctcctcaaccgcaagcttag

DBGET integrated database retrieval system