KEGG   Eucalyptus grandis (rose gum): 104441883Help
Entry
104441883         CDS       T03547                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00052  Galactose metabolism
egr00500  Starch and sucrose metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104441883
   00500 Starch and sucrose metabolism
    104441883
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104441883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 104441883
NCBI-ProteinID: XP_010053435
UniProt: A0A059CH63
Position
Un
AA seq 653 aa AA seqDB search
MAEPYPSRSPVDQEDPGYAPLAGGEEPRDHRRPIRAILAVGLSVLLVVGIVIGFSTDTSP
DVCAEVNSARLEPFLLGGAGQRSVPVKTVVRPVPRGVNEGVSAKSNRVFAGANLRGFPWN
NSMLSWQRTAYHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPDAAVWGNIVWGHAVSEDLI
HWLYLPLAMVADQWYDINGVWSGSATVLPDGQVMMLYTGSSNESQQLQNLAYPANLSDPL
LIDWVKHPGNPILAPPQCIDKLDFRDPTTAWYTSGGKWRFAVGAKINKTGVSFVYETEDF
KSYKLLPGLLHAVPGTGMWECVDFFPVSDDGLDTSVNGPGVKHVMKVSLDDDRHDYYAIG
TYNEEANTWVPDSPEIDVGIGIRYDYGIFYASKTFYDQNKSRRILWGWITESDSEYADVQ
KGWASLQALPRTIVLDTKTGSNLLQWPVEEVDSLRLSSKEFDSVEVEAGTVVPLDVETAT
QVDIVAEFELDKQALEAAPEADADYVCSASGGASQRSALGPFGLLVLADDDLSEQTPVYF
YVVKGPNGTLKTSICTDQSRSSVATDVHKQVYGSFVPVLEGEKLSLRILVDHSIVETFAQ
GGRSCITARVYPTKAIYGAARVFLFNNATEANVKASLKIWQMNSAFIRPYSPQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccctacccaagccggtctcctgttgatcaggaggaccccgggtacgcccct
cttgccggcggggaggagccgagggaccaccgccgaccgatccgggcgatcttggcggtg
ggactttctgtgttgctggtcgtggggatagtgatcggcttctcgaccgacacaagcccg
gatgtctgcgcggaggtcaattctgctcggctggagccgttcctcctgggaggagcgggg
cagaggtcggtgccggtcaagacggtggtcaggccggtgcctcgcggcgtgaatgaagga
gtgtccgcgaagtcaaaccgggtcttcgctggtgccaacctgcggggcttcccgtggaac
aacagcatgctgtcgtggcagagaacggcttaccatttccagccggagaagaactggatg
aatgatcccaacggtcccatgtattacaaaggctggtaccacttcttctaccaatacaac
ccggacgccgccgtctggggcaacatcgtgtggggccacgccgtgtcggaggacctgatc
cactggctctacctccccctcgccatggtggccgaccagtggtacgacatcaacggcgtg
tggagcggttccgccacggtcctccccgacggccaagtcatgatgctctacaccggctcg
tccaacgagtcccagcagctccagaacctcgcctaccctgccaacctctccgacccgctc
ctcatcgactgggtcaagcaccccggcaaccctatcctagcgcctccgcagtgcatcgac
aagttggacttccgtgacccgacgaccgcctggtacacgtccggaggcaaatggcgcttt
gcagtcggggccaagatcaacaagacgggagtgtcgtttgtgtacgagaccgaggacttc
aagagctacaagctcttgccgggcctgctccatgccgtccccggcacaggcatgtgggaa
tgtgtggactttttcccggtctcggatgacgggttggacacgtcggtgaatggtccggga
gtgaagcacgtgatgaaggttagcctcgacgacgacaggcacgattactatgcgatcggg
acttacaacgaggaggccaacacttgggtcccggacagccccgagattgacgtggggatc
gggattaggtatgactacggtatattctacgcctcgaagacgttctacgaccagaacaag
agtaggcggatcttgtggggttggatcacggagtcagacagcgagtacgccgatgtgcag
aaaggatgggcttcacttcaggcacttccgaggacaattgttctcgacacgaagaccgga
agcaacctgcttcagtggccggtggaggaagtagacagcttgagattaagcagcaaagaa
ttcgacagcgtagaggttgaagccgggacggtggtgcctctagatgtcgaaaccgccaca
caggtggacatcgtggcagaatttgagctggacaaacaggccctagaggcggcacccgag
gctgatgccgattatgtttgcagcgccagcggtggggcctctcaacgaagtgctctagga
ccgttcggcctcttggttcttgcagacgatgacctatccgagcagactcctgtgtacttc
tacgtcgttaagggaccgaacggcaccctcaagacttccatctgcactgaccaatcgaga
tcttccgtggcaaccgatgtccacaagcaagtctacggaagcttcgtcccggtacttgaa
ggcgagaagttgtcgctcagaatactggtggatcactcgatcgtagagaccttcgcacag
ggagggaggagctgcatcacggcccgcgtttacccaaccaaggccatctacggggccgcc
cgggtcttcttgttcaacaatgccaccgaggctaatgtcaaggcctcgctcaagatatgg
cagatgaactctgctttcatccgcccgtacagcccccagtga

DBGET integrated database retrieval system