KEGG   Eucalyptus grandis (rose gum): 104442789
Entry
104442789         CDS       T03547                                 

Definition
(RefSeq) GATA transcription factor 2
Organism
egr  Eucalyptus grandis (rose gum)
SSDB
Motif
Pfam: GATA
Other DBs
NCBI-GeneID: 104442789
NCBI-ProteinID: XP_010054482
UniProt: A0A059DH00
Position
Unknown
AA seq 286 aa
MEFCRNVSVPGDSQPKLGGFASNSLDELFSNQKPEADVSMEWLSVFVEDCLSSSGNTLQV
QTLPTPSSASVPSKTPSKPSSTNLPSLHKIVVTGKARSKRKRIAAAKTKNNAFLMMPAWP
NHSADPLLLHQSHWLADSELIEPKKQEQEQEQPKKQEQELPKTTTTNMPSSPTQCDAEEE
EAVESKEDHSEESGGGGGGGAGQQGTGRRCTHCLSQRTPQWRAGPMGPKTLCNACGVRYK
SGRLLPEYRPAKSPTFVSYLHSNSHKKVMEMRSSNVSLLSPSGERR
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagttctgccggaatgtgtcggttcccggagactcgcagccgaagctcggtggcttc
gcaagcaacagtcttgacgagctcttctccaatcagaagccggaagctgatgttagcatg
gagtggctgtcagtctttgtggaggactgcttgtccagcagtggaaacacactccaggtc
caaacactaccgacgccttcctcagcatcagttccttccaaaacgcccagcaagccttcc
tcgacaaatttgccgtcgctccacaagattgtggtcacaggcaaggcgaggagcaagagg
aagagaatcgcagccgccaaaaccaagaacaacgcgttcctgatgatgcccgcttggccc
aaccactccgccgacccgctcttgctccaccagtcccactggctcgccgacagcgagctc
attgagcccaagaagcaagaacaagaacaagaacagcccaagaagcaggaacaagaactg
cccaagacaaccaccaccaacatgccaagtagtcccacgcaatgcgacgcagaggaggag
gaagcggtggagagcaaagaagaccactcggaggagagcggaggcggcggcggcggagga
gcagggcagcaggggacggggaggaggtgcacccactgcctgtcgcagaggacgccgcag
tggagggcggggccaatggggccgaagacgctgtgcaacgcgtgcggggtgaggtacaag
tcgggccggctgctgccggagtaccggccagccaagagccccaccttcgtgagctacttg
cactccaactcccataagaaggtcatggagatgaggagttcgaacgtctccctcctctcc
ccttccggcgagaggaggtga

DBGET integrated database retrieval system