KEGG   Eucalyptus grandis (rose gum): 104443077Help
Entry
104443077         CDS       T03547                                 

Definition
(RefSeq) uncharacterized protein LOC104443077 isoform X2
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00460  Cyanoamino acid metabolism
egr00500  Starch and sucrose metabolism
egr00940  Phenylpropanoid biosynthesis
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104443077
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    104443077
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    104443077
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     104443077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 104443077
NCBI-ProteinID: XP_010054740
UniProt: A0A059DI26
Position
Unknown
AA seq 631 aa AA seqDB search
MKKMARAPIFMVGILVLCCFSGVTRAEYLKYKDPKQPLNTRINDLLSRMSLEEKIGQMTQ
IERSVASFEVMKKYYIGSVLSGGGSVPAPQASAETWIDMVNDFQNGSLSTRLGIPMIYGI
DAVHGHNNVYRATIFPHNVGLGATRDPALVKRIGAATALEVRATGIPYVFAPCIAVCRDP
RWGRCYESYSEDPKIVQAMTEIIPGLQGDLPAGSRKGVPYVAGKKNVAACSKHYVGDGGT
TNGVNENNTVTDWHGLLGIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANGNLVTGFLKN
KLRFRGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMVMVPSNFTEFIDGLTFQVKN
KIIPMSRIDDAVRRILRVKFTMGLFEDPLADTSLVNQLGSQEHRELAREAVRRSLVLLKN
GEGADAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIQWQGLSGNNLTSGTTILSAIKNT
VDPKTKVVYEENPDTDTVKSGKFSYAIVVVGEHPYAETFGDSSNLTIADPGTSTIGNVCG
AVKCVVVIISGRPVVIQPYVAVMDAIVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKT
VDQLPLNVGDPHYDPLFPFGFGLTTAPVKRN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatggcgagagctcccatctttatggtggggattctagttctctgttgtttc
tccggcgtgacgagagcggagtacctgaagtacaaagatccgaagcagccgctgaacacc
cgcatcaacgacctgctgagccgtatgagtctggaggagaagataggccagatgacgcag
atcgaacgcagcgtcgcgtccttcgaagtcatgaaaaagtactacatcgggagcgtattg
agcggaggagggagcgtcccagctccgcaggcctctgcggagacttggatcgacatggtg
aacgatttccagaacggttccttgtctacccggctcggcatccccatgatttatgggatt
gacgcggtccacggccataacaacgtgtacagggcgacgatatttcctcacaatgtcggt
cttggagccaccagggatcctgcgctagtcaagaggatcggagctgcgaccgcactggaa
gtgagagccacagggattccttatgtttttgcgccctgtattgcggtctgcagggatccg
cgatggggtcggtgctacgagagctacagcgaagatcccaagatcgttcaggccatgacc
gagattatccccggattgcaaggtgatcttcctgctggttctcgaaagggtgtcccctac
gtcgccggaaagaaaaatgtggctgcatgctcaaagcattacgttggcgatggcggaacg
accaatggcgtcaatgagaataacactgtaacagattggcacggcttgcttggcatccat
atgccgggttactacacttcaatcatcaagggtgtctcaaccgtcatggtttcgtactct
agctggaatggagtcaagatgcatgctaatggcaatctagtcacaggcttccttaaaaac
aagctccgtttcagagggtttgtcatatcagattgggaaggtattgacaggatcacctct
cccccccatgctaactattcctactccattcaagcaggaattagtgcgggcattgacatg
gtaatggtcccgtcgaatttcacggagttcattgatgggctaaccttccaggtgaagaat
aagatcatccccatgagccgaatcgatgatgcggtgaggagaatactgcgagtcaaattc
acaatgggcctattcgaggatccactggccgataccagcctagtgaaccagctaggaagt
caggagcatagagaattggctagggaagctgtcagaaggtccttggtgctcctgaagaat
ggcgaaggagctgatgcgccattacttcctcttcccaagaaagcgccaaaaatacttgtt
gctggtagccatgcagataacttggggtatcagtgtggtggatggacaattcaatggcag
ggactaagtggcaacaacctcactagtggtacaacaattctcagtgccattaagaacact
gttgatccaaaaaccaaggttgtctatgaggagaacccggacacggacaccgtcaaatct
ggcaaattctcttatgccattgtagtagtgggagaacacccttatgcagagacatttggc
gatagctcaaacttgaccattgccgacccaggtacaagcaccatagggaatgtatgtgga
gctgtgaagtgtgtggtcgtcatcatctccggtcgtcctgtcgtgatccagccctatgtc
gcagtgatggatgctatcgtcgctgcttggcttccaggaactgaaggccaaggggttgca
gacgttctgtttggtgattatggcttcacaggcaagcttcctaggacatggttcaagacc
gtggatcagcttccattgaatgttggggatcctcattacgatcccctcttcccatttggt
tttggtctcaccaccgctcctgttaagaggaactaa

DBGET integrated database retrieval system