KEGG   Eucalyptus grandis (rose gum): 104443743
Entry
104443743         CDS       T03547                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00100  Steroid biosynthesis
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Module
egr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104443743
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104443743
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 104443743
NCBI-ProteinID: XP_010055559
UniProt: A0A059C103
Position
Unknown
AA seq 370 aa
MDLAALLLPALIPSWSSVVLLGTFFAYLAAAGSILPGKVVPGAALPDGSRLRYRCNGLVS
LLLLVALLGLGAWMDFLRPTIIAERGLELLSTTFTFSILVTLVLYAAGCNSTSDSSSLKP
HLSGNLIHDLWFGIQLNPQFIGIDLKFFFVRAGMMGWLLINLSVLARSVQDGNLSLSMIL
YQLFCVLYILDYFVYEEYMTSTWDIIAERLGFMLVFGDVVWIPFTFSIQGWWLLRNNVEL
TTTAAIANCFVFLIGYMVFRGANKQKHVFKRSPKALIWGQPPKVVGGKLLASGYWGIARH
CNYLGDLLLALSFSLPCGLSSPVPYFYPIYLLILLIWRERRDEARCAEKYREIWAEYCRL
VPWRIFPFIY
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggatctcgctgctctccttcttcccgctctgatcccttcgtggagctccgtcgtcctg
ctggggacgttcttcgcttacttggccgccgccggctcgatcctccccgggaaggtcgtc
cccggcgcggcgctgccggacggctctcggctgcgctatcgctgcaatggtttggtgtct
cttcttctcctggtcgctttgctcggcctcggtgcttggatggacttcctccgacccacc
ataatagcagaaaggggacttgagctgctgtcgacgacttttacattcagcattcttgtt
acgttagtactctacgctgctgggtgcaattcgactagtgacagttcctccctaaagcct
cacctgtcaggaaacctcattcatgacttgtggtttggaatacagctgaatcctcaattt
attgggatagacctcaagtttttctttgtacgagcaggtatgatgggatggcttcttatc
aatttgtcagttctagctagaagtgtccaagatggcaacttgagcctatcaatgatcctt
tatcaactattctgtgtgttatatatcctggactactttgtgtatgaggagtatatgact
tccacgtgggacattattgccgagagattgggcttcatgttggtatttggagatgtagtg
tggattcccttcacatttagcattcagggttggtggctattgagaaataacgtagagtta
acaacaactgctgccattgctaattgtttcgtatttctgattggatatatggtgttccga
ggagctaacaagcaaaagcatgtgttcaaaaggagtcccaaagcacttatatggggtcaa
cctccaaaagttgtaggggggaagttgcttgcttctggttattggggaattgcgaggcac
tgtaactaccttggcgacttgctgctggcactgtctttcagcttgccttgtggactaagt
tcaccagtaccttatttctacccaatctatctcctgattctgctgatatggagagagaga
agagacgaagctcgttgtgcagaaaagtacagagagatttgggcggaatactgcaggcta
gttccttggaggatattcccctttatctattag

DBGET integrated database retrieval system