KEGG   Eucalyptus grandis (rose gum): 104444349Help
Entry
104444349         CDS       T03547                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP43 isoform X1
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:egr03009]
    104444349
Enzymes [BR:egr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104444349
Ribosome biogenesis [BR:egr03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    104444349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL FabA
Motif
Other DBs
NCBI-GeneID: 104444349
NCBI-ProteinID: XP_010056309
UniProt: A0A059C487
Position
Unknown
AA seq 516 aa AA seqDB search
MAFWGVEVKPGKPFVHPSSGARQRLHISQATLGIGSATNKSIVQCNVGNKSPVFLCSLFP
DGAESSQLNLEFEEAEEVTFSVVGPRSVHLSGFYLGSGRHYAGDDESESYGEDIAGTDTE
RSNDEDDYEDSFIDDDDNPEIFSPSPSPSLNEAVHGESDNEKARERKGRKRRLRKKYHLG
ESDEKGSFEQNNIVDDKAKAQASESEDEEGFFISSLLKKKDVVKDSKIDGPEEKPQSGIP
EVGTKMKRKRNEEFIESPIEVDKANTHDKVKESQGWQGQGIAGADNREAGQVNGFAPTSD
EATNQNALKKRKKKHANEKSQPEEDIVENSMNPVVPENLVLDAPQVTGGADSEKKDIKKK
KKKDRAQHSEADITNQENVLPADGKVRLDTKMKDTDTDDACQVRKLPNGLTIEELEIGNP
DGKVTAPGKKISVCYVGKFMENGLVFDSNISGKPLKFRLGSGEVMKGWDDGLDGMRIGGK
RRLTIPPSLCCANSRTGHKVPPDSWLVYDIEVVRVR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctttctggggtgtcgaggtgaaacccggtaaacccttcgttcatccctcgagtggg
gccagacagcggctccatatctcgcaggcgacgctggggatcggttccgccacgaacaaa
agcatagttcagtgtaatgtggggaacaagagtcccgttttcctgtgctctttgttccct
gacggggccgaatcgtctcaactgaatttggaatttgaagaagctgaggaagtcaccttt
tctgtcgttggccctcggagcgtccacctctccggtttctacctgggaagtggtcgacat
tacgccggagatgatgagtcagaatcatatggtgaagatatcgctgggactgatacagag
agatccaatgatgaagatgactatgaagatagtttcattgatgatgatgataatccagaa
atattttcgccttctccttctccttcactaaatgaagctgtacatggggaatcagataat
gaaaaagctagggagaggaaaggcagaaaaagaagacttagaaagaaatatcatctcggt
gaatctgatgaaaaaggtagttttgaacagaataatattgttgatgacaaggccaaggca
caggcatcagaaagtgaagatgaagagggcttctttatatcttccttgcttaagaaaaag
gatgtggtgaaagactccaagatagatggcccagaagagaaacctcaaagtggaatccct
gaagttggcacgaagatgaagaggaagagaaatgaagaatttatagagtcccctatagaa
gttgacaaagctaatactcatgataaggtcaaggagagtcaaggctggcaaggtcagggg
atcgcgggtgctgataacagagaagctggtcaggtcaatggtttcgccccaacatctgat
gaggccaccaatcaaaatgctttgaaaaagagaaagaagaaacatgcgaatgagaagtct
caaccagaagaagacattgttgagaacagtatgaatccagttgttccagagaatttggtt
cttgatgctccgcaagtaactggcggagcagattctgagaagaaagacataaagaagaag
aaaaagaaggatagagcccagcatagtgaggcagatataacaaaccaggagaatgttcta
ccagcagacggaaaggttaggttggacaccaagatgaaagacacagacactgatgatgcc
tgccaagttaggaagctgccaaatggactaacaatcgaggagcttgaaattggaaatcct
gatggtaaagtcactgctcctggtaaaaaaattagtgtttgctatgttggcaagtttatg
gagaatgggctggtatttgattcgaatatcagtgggaaacccttaaaattccgcctaggt
tctggagaagttatgaagggttgggatgatggccttgatggcatgcgaattggtggcaaa
agaaggcttactattccaccctctctgtgctgtgcgaatagcagaactggtcataaagtt
cctcccgattcatggttggtctatgacatcgaagtggttcgtgtccgctag

DBGET integrated database retrieval system