KEGG   Eucalyptus grandis (rose gum): 104446168Help
Entry
104446168         CDS       T03547                                 

Definition
(RefSeq) transcription factor MYC2
Organism
egr  Eucalyptus grandis (rose gum)
SSDB OrthologParalogGFIT
Motif
Pfam: bHLH-MYC_N HLH
Motif
Other DBs
NCBI-GeneID: 104446168
NCBI-ProteinID: XP_010058368
UniProt: A0A059C292
Position
Unknown
AA seq 447 aa AA seqDB search
MEELTSCASSSSVVPLHHETSPPLQQLVHLILQARPEDWVYSIFWQPSRDDHGRLVLTWG
YGHFRGTTREPFASKPTTNRVLEEAQCPDGQFAHSSDISDPEWYYIFSVMRSYSSEDGIL
GRAFRSGGHIWLSGENHHELEMCECDERVKEARMHGIQSIVCISIADGSGVLELGSSEII
QEDWSLVLLAKTLFPAHFSSPLINSRVENPSDDAKEEPALVGASKGPYAKPVQRHNISEK
SGRKKTVDEDDKESSSSLRLSGPRRNVEAERQRRNKMNQQFYALRSVVPNISRMDKASLL
ADAVDYIKELQSRFATLESKLVKSEPSSPKRLKSNKTVSYFNDMSKITSLSSKNSSTALA
VPGRREMAVDVKMVNQEAVIRVWSPNLDHPCARLMDMLKELEFKVQDANMSCMKGMMLQE
VVIRTPVDRWVSDKSIRDAIRSKLGKE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactcacatcttgtgcttcctcctcctcagttgtccctcttcatcatgaaacc
tcaccccctctccagcagctcgtccacttgatcctccaagcccgacctgaggactgggtt
tactccatcttttggcagccctcaagagacgaccacggccgtcttgtcctcacttggggc
tatggccatttccgaggaactacaagggaaccatttgcatccaagcccaccacaaatagg
gtactcgaagaagcccagtgtccggatggtcagttcgctcacagcagcgacatcagcgac
cctgagtggtactatatcttctccgtcatgaggtcatattcctcggaagacggcattcta
ggaagagcatttcgctcaggtggtcacatctggttgagtggtgaaaaccaccatgagctg
gagatgtgtgagtgtgatgagagggtcaaagaagcaagaatgcacggaatccaaagcata
gtgtgcatatcaattgctgatggttctggggttcttgaattgggctcctcagagatcatc
caagaagattggagcttagtccttttagccaagaccctcttcccggctcatttctcgagc
cctctaatcaattctcgtgtggagaacccatccgacgatgccaaagaagaaccggcactt
gtcggtgccagcaagggcccatatgctaaacctgtccaacgccataacatatctgagaag
agcggtaggaagaaaacagtggacgaagacgataaagaatcatcatcatccctacggctg
tctggtccgaggagaaacgtggaggcagagcggcagcggaggaacaagatgaaccagcag
ttctatgcactccgctccgttgtccccaatatatcaagaatggacaaggcgtccctcctc
gccgatgccgtggactacatcaaggaactccagtcccgttttgccacattggagtccaag
cttgttaagtccgagccgtcatctccgaagcgcctcaaaagtaataagactgtttcctac
ttcaatgacatgagtaagataacatcgctgtcaagcaagaatagctcgacggctttggct
gtcccgggccggagagagatggcggtggacgtgaagatggtgaatcaggaggcggtgatc
cgggtgtggagcccgaatctggaccacccctgcgcgaggttgatggacatgctcaaggaa
ttggagtttaaggtccaggacgcgaacatgtcttgcatgaaggggatgatgcttcaggaa
gtggtgattaggactccggtcgaccgctgggtcagcgacaagtccatcagagatgccatt
cggagtaagctaggcaaggagtga

DBGET integrated database retrieval system