KEGG   Eucalyptus grandis (rose gum): 104450472Help
Entry
104450472         CDS       T03547                                 

Definition
(RefSeq) biotin--protein ligase 2 isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00780  Biotin metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    104450472
Enzymes [BR:egr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     104450472
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     104450472
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     104450472
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     104450472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2 DUF1995
Motif
Other DBs
NCBI-GeneID: 104450472
NCBI-ProteinID: XP_010063344
UniProt: A0A059BY35
Position
Unknown
AA seq 367 aa AA seqDB search
MLSAASLRSFSLQRSRVFVRLRSPTKPILSRAAPAAAEEMDSQSPSCVLVLAGKSSAEME
IAKTLKSNNALKLPDNSEVRFFVHPEIQRPPSEEPFQIDLFLKSLSTNQFGRFFIWSPRL
PSTHDVVSHNFCELPIGAVCAADIQSKGRGRSKNVWESPIGCLLFSFTIQMDDGKIVPLL
QYVISLAITEAIKEICDKNGLPYLDVRIKWPNDLYLNGLKVGGILCTSTYKSKKFNVSAG
IGLNVDNEKPTVCLNAVLRETSVASYKFTREDILAAFFNKFETLYNLFIHQGFQALEELY
YKTWLHSGQRVIVQEKNGEQVVENVVSIQGLTPSGYLLAVGEDNQMCELHPDGNSFDFFK
GLVRRKL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgcagcttctctccgcagcttctctctgcagcgttcccgcgtcttcgtccgc
cttcgatctcccacgaagccgatcctctcacgcgctgcaccggcggccgcggaagaaatg
gactcgcaatcgccctcctgtgttctagttttagccgggaaatcttctgcagaaatggaa
attgcgaaaactttgaagagcaataatgctctcaagctccctgacaacagtgaagttaga
ttctttgtccatccagaaattcaaaggccaccgagtgaagagcctttccaaattgatttg
tttctgaagtccctttcgacaaatcagtttggtaggtttttcatttggtctccacgcttg
ccatcaactcatgacgtcgtttcgcacaacttttgcgaacttcctattggtgcagtgtgt
gctgctgacattcaatcgaaaggacgaggaaggtcaaagaatgtttgggaatctccaatt
ggttgcctcctattctcttttacaattcagatggatgatgggaaaatcgtgcctcttctg
cagtatgtaatttcgctggctattactgaggctataaaggagatatgtgacaaaaatgga
cttccctaccttgatgttagaataaaatggcccaatgatctttacctaaatggccttaaa
gttggcggcattctgtgcacatcaacttataagtcaaagaagttcaatgttagtgccggt
atcggcttgaatgttgataatgagaaaccaaccgtatgcttgaatgcagtcttgcgagaa
acatcagttgcttcttacaaatttacacgagaggatatccttgcagcttttttcaataaa
tttgagactttgtacaatctatttatacatcaaggattccaagctctagaggagctgtat
tataagacatggctacatagtggtcagagggtaatcgtacaggagaagaacggggagcag
gtggtggaaaatgttgtgagtatacagggactgacgccatcagggtaccttttggctgtt
ggtgaagacaaccagatgtgtgagcttcatcctgatggcaacagttttgacttcttcaaa
ggactggtcagacggaagctttga

DBGET integrated database retrieval system