KEGG   Eucalyptus grandis (rose gum): 104451041Help
Entry
104451041         CDS       T03547                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00250  Alanine, aspartate and glutamate metabolism
egr00650  Butanoate metabolism
egr01100  Metabolic pathways
Module
egr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104451041
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104451041
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     104451041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104451041
NCBI-ProteinID: XP_010064094
UniProt: A0A059BYY4
Position
Unknown
AA seq 533 aa AA seqDB search
MAMAMGMAGAAVRSARHRTGGSIRHLPSMRASSPPLSRQITMDAQSLAGRLKASGLLRSQ
GLVGGKWVDAYDGNTIKVHNPATGEVITEVPCMGSRETKDAISSAYDAFQSWSKVTAAER
SRHLRKWYDLLISHKEELGQLITLEQGKPLNEAIGEVGYGASFIEYFSEEAKRVYGDIIP
APLADRRLFVLKQPVGVVGAITPWNFPLAMITRKVGPALACGCTVVIKPSELTPLTALAA
AELSLQAGIPPGVVNVVMGKASDIGDSLLESSQVRKITFTGSTAVGKKLMAGAAATVKKL
SLELGGNAPCIVFDDADVDVAVKGTLAAKFRNSGQTCVCANRVIVQEGIYEKFATAFSNA
VQNLQVGNGFSEGVAQGPLINEAALHKVESFVEDAIHKGAKILLGGRRHSLGRTFYEPTV
MGDVKSDMLISREEVFGPVAPLLRFRTEEEAIRMANDTNAGLAAYIFTSNVQRTWRVTEA
LEYGIVGVNEGIISTEVAPFGGVKQSGLGREGSKYGIDEYLELKYVCLGNMAH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgatggggatggccggagcggcagttcgatccgcgcggcatcgcacgggt
ggctccatccgacacttgccttccatgcgcgcctcctctcctcccctctcccgccagatt
accatggatgcccagagtctcgctggtaggttgaaagcttctggcctattacggagtcag
gggcttgttggaggaaaatgggttgatgcatatgacggcaatactatcaaggtgcacaat
ccagcaaccggtgaagttattacagaagtaccctgcatgggctcacgagagacaaaagac
gcaatatcttccgcctatgacgcattccaatcttggagcaaagtgactgcggccgagagg
agcagacatctgagaaaatggtatgatttgctaatctcccacaaggaagagttgggacaa
ttgataactttagagcaagggaaaccattgaacgaggccattggagaggttggctatggg
gcaagttttattgagtacttctccgaggaggcaaaacgtgtatatggagatatcattccg
gcaccactagccgatcgtcggttgtttgtgttgaagcagcctgtcggtgttgttggtgca
attactccatggaactttccattggctatgattactcgaaaggttggcccagctcttgct
tgtggctgtacagttgttataaagccctcggagcttacacctcttacagctctagccgca
gctgagctttcccttcaggctggaataccaccgggtgttgttaatgtagttatggggaag
gcttctgatataggagattctctactggaaagctctcaggtcaggaaaattacatttact
ggctcaacagctgttgggaaaaagttgatggctggtgcagctgcaacggtcaagaagtta
tctctagagcttggcgggaatgcaccatgcatagtgtttgacgatgcagatgtggatgtc
gctgtaaaaggaactcttgctgcaaagtttcgcaacagcggtcagacctgtgtttgtgcg
aacagagtcattgtacaagaaggcatatatgaaaaatttgctactgcattttccaatgcc
gttcagaatctgcaagttggcaatggctttagtgaaggcgttgctcagggtcctctaatc
aatgaagctgcgctacacaaggttgaatcatttgttgaagatgctatacacaagggagcc
aaaatccttcttggaggcagaagacacagcctgggaaggaccttttatgagcctacagtt
atgggtgatgtaaaaagcgatatgcttatttcaagagaggaagtatttgggccagtagct
ccgcttttgcgttttcgaactgaggaagaagctatccgcatggccaatgacaccaatgca
ggtctggctgcttacattttcaccagcaatgttcaacgtacatggcgtgtcaccgaggcc
cttgaatatggtatagtaggggttaatgaaggaataatctcaacagaggtggctcctttt
ggtggcgtcaagcagtctggacttggacgggaaggttcaaagtatggaattgatgaatat
ctggagctaaaatatgtgtgccttggaaacatggcacactga

DBGET integrated database retrieval system