KEGG   Eucalyptus grandis (rose gum): 104453612Help
Entry
104453612         CDS       T03547                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00860  Porphyrin and chlorophyll metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    104453612
Enzymes [BR:egr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     104453612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 PrmA Methyltransf_18 Methyltransf_32 MTS Ubie_methyltran CMAS TM1506 Met_10 AviRa
Motif
Other DBs
NCBI-GeneID: 104453612
NCBI-ProteinID: XP_010066519
UniProt: A0A059BE22
Position
Unknown
AA seq 329 aa AA seqDB search
MACSVSLTSPICFHNANNGKTALNPSPIKTAKATPRLRTFTQFAIPPLSTAAADFASVDG
AAIAVIGGSSVAALAAVLTLTDPERRRQLQAEEVGGKDKEVVREYFNNSGFQRWKKIYGE
TDEVNKVQRDIRLGHSKTVENVMKMLTDEGSLQGVTVCDAGCGTGCLAIPLAKEGAIVYA
SDISAAMVSEAEKQAKEQLQITNDDQSSPPTMPKFEVSDLESLKGKYDTVICLDVLIHYP
QSQADGMIAHLASLAESRLILSFAPKTFYYDLLKRVGELFPGPSKATRAYLHAEADVERA
LQKVGWKIKERGLITTQFYFARLVEAVPA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctcggtgtccttgacatcccccatttgcttccacaatgcgaacaacgggaag
actgcactgaatcctagcccaatcaagacggcaaaggcaacaccgaggttgagaacgttt
acccagttcgcgattccgcccctctccactgcggcagccgactttgcgtccgtggatggc
gcagcaatcgccgtcattggcggcagctcagtggctgctttggccgctgtgctcacactg
acggatccagagaggaggcggcagctccaggcagaggaggtgggcggtaaagacaaggag
gtggttagggagtacttcaacaactcagggttccagagatggaaaaagatatatggcgag
acagatgaagtcaataaagtccagcgtgacatacggcttgggcactccaagaccgtggag
aatgtgatgaagatgttgactgatgaggggtctcttcaaggggtcaccgtctgtgatgct
gggtgtggcacggggtgcctcgctattccactggcaaaggaaggcgctatcgtatatgcc
agtgatatctctgctgctatggtttccgaggccgagaaacaggcgaaagagcagcttcaa
atcaccaacgatgaccaatcatctcctccaactatgccaaaattcgaagtgagtgattta
gagagcctaaaagggaagtatgatacggtgatatgtttggatgttctcatacattaccca
cagagtcaggctgatgggatgatcgcccaccttgcttcactggcagagagtcggttgatt
ctgagctttgctccaaagacgttctactatgatttgttaaaaagggtaggggaattattc
ccaggaccttccaaggcaacaagagcttatttgcatgctgaggcggatgtcgagagggca
ttacagaaggttgggtggaaaataaaagagagaggcctaatcaccactcagttttacttt
gcgagacttgtcgaggctgttcctgcatag

DBGET integrated database retrieval system