KEGG   Eucalyptus grandis (rose gum): 104455913Help
Entry
104455913         CDS       T03547                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00010  Glycolysis / Gluconeogenesis
egr00562  Inositol phosphate metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104455913
   00562 Inositol phosphate metabolism
    104455913
Enzymes [BR:egr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104455913
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104455913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104455913
NCBI-ProteinID: XP_018715152
UniProt: A0A059BI35
Position
Unknown
AA seq 494 aa AA seqDB search
MARGMAVALLLMLTAIAGAGYAAEEAFDVREHICTVTRYGAVKDVASNAYVPSSVPDGCT
PIHLNLVARHGTRNPTKKRMRQLENLASHIQELVRDAEEKNLAHNIPAWLRGWMSPWKGK
AKGGELISEGEDELYDLGIRTRERFPELFSQDYHPDIYRLKATQVPRAAASAVAFGMGLF
SGKGTLGPGKHRAFAVTSDASDILLRFFDSCANYKDIRKKQEPAVDKLKEPILDEITGAI
ANRYKLNFTRQDTASLWFLCKEEASLLDITNQACALFNPNEVALLEWTDDLEVFMLKGYG
KALNYRMGVPLLKDVIQSMEEAIQANEEKHPPGSYEKARLQFAHAETVVPFSCLLGLFLE
GSEFEQIQREQPLPHPSRPPHNRNWRGSIVAPFGGNNMLVLYSCPANLSSKYYVQVLHNE
HPTSMPGCGGADSCPFEVFKEKIAAPHLKHDYNALCNVKAAQVEQSSVDSKLSALYRWLF
PPGINELGAHGNEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggggtatggcggttgcgcttctgctgatgctgactgcgatcgcaggcgctggt
tacgcggccgaagaagctttcgatgtgcgggagcatatttgcactgtcaccaggtatggt
gcggtgaaggacgtcgcgagcaacgcctacgtgccgtccagtgtgcccgatggatgtact
cctattcacttaaatcttgtggctaggcatggaactcgcaatccaaccaagaagcgaatg
agacagttggaaaatttggcttctcacatacaggaactcgtaagagatgctgaagaaaag
aatttagcacataatattcctgcttggttgcggggatggatgtctccttggaaggggaaa
gcgaaaggtggagagttaattagcgaaggagaagacgagttgtatgatcttggaatcagg
acccgtgaaagatttcctgaattgttcagtcaagactaccatcctgatatatatagactg
aaagcaacacaggtcccccgggcagcagcaagtgctgtggcttttggaatggggctattt
agtggaaaaggaactcttggaccagggaagcatcgagcttttgccgtcaccagtgatgca
agtgatattttgctcagattttttgattcttgtgcaaattacaaggatattagaaaaaag
caggagcctgctgttgataagcttaaggaacccattttggacgaaattaccggggctata
gcaaatcgctataagttgaattttacaaggcaggacacagcttctctctggtttctctgc
aaagaggaggcatcactgttggatataaccaatcaagcatgtgctcttttcaaccccaat
gaggttgctttgctggagtggaccgatgatttggaggtgtttatgctaaaaggatatggt
aaagcactgaactacagaatgggcgtacctttgctgaaagatgtcattcaatccatggag
gaagctattcaggcgaacgaagaaaagcatcctccaggaagttatgagaaagctagactt
caatttgcgcatgctgaaactgtggttcctttttcctgtctcctaggccttttccttgaa
ggatctgagtttgagcaaatccagagagagcaacctttgccacatccttcaagacctcct
cataacagaaattggagggggagcatcgtggcaccttttggtgggaataatatgctggta
ctttatagttgtcctgctaatctttcaagcaagtactacgtgcaagtactacacaatgaa
catcccacttccatgccgggttgcggtggtgctgattcttgtccatttgaagttttcaag
gaaaagatagcagctccccatttgaagcatgattataatgcattatgtaatgtgaaggct
gctcaggtggagcagagttctgtggatagtaagttgtcagcattgtaccgttggcttttc
ccgccgggaatcaatgagctaggtgcccacggaaatgagttgtaa

DBGET integrated database retrieval system