KEGG   Eucalyptus grandis (rose gum): 104456088Help
Entry
104456088         CDS       T03547                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00020  Citrate cycle (TCA cycle)
egr00640  Propanoate metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104456088
   00640 Propanoate metabolism
    104456088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egr04147]
    104456088
Enzymes [BR:egr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104456088
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104456088
Exosome [BR:egr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104456088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 104456088
NCBI-ProteinID: XP_010069114
UniProt: A0A059AUA6
Position
Unknown
AA seq 423 aa AA seqDB search
MVRAALLKRLVSNSLTVAGKPQHHQLRRLNIHEYQGAELMSKYGVNVPKGVAVSSAEEIK
KAIQEVFPNEKELVVKSQILAGGRGLGTFTNGLKGGVHIVKADEADQIAGKMLGQILVTK
QTGPQGKVVSKVYICEKLSLINEMYFAITLDRKTAGPIIIACSKGGTSIEDLAEKYPDMI
IKVPIDVFQGITDEDAAKVVDGLALKAADKKAAIDQVKKLYELFCACDCTLLEINPLAET
SDSQLVAADAKLNFDDNAAYRQKETFAYRDPTQEDPREVAAAKADLNYIGLDGEIGCMVN
GAGLAMATMDIIKLHGGTPANFLDVGGNASESQVVEAFKILTSDEKVKAILVNIFGGIMK
CDVIASGIVNAAKQVSLKVPVVVRLEGTNVDQGKRILKESGMTLITAEDLDDAAEKAVKA
LAS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagcagcgttgctgaagaggctggtctccaactccctcacggtggccggcaag
ccccagcaccaccagctccgccgcctcaacatccacgagtaccagggtgctgagttaatg
agcaaatatggcgttaatgtcccaaagggtgtcgccgtttcttctgcggaggagatcaag
aaggcaatccaggaagtgtttcctaatgaaaaggagttagttgtcaaaagccaaatactt
gctggtggaagaggattgggtacgttcacgaatgggctaaaaggtggagtgcatattgtc
aaggctgatgaggctgaccaaatagctgggaagatgcttggacagatacttgtgaccaaa
caaactgggcctcaagggaaagttgtcagcaaggtttacatatgtgaaaagctttctctt
atcaatgagatgtactttgccatcactctggatcggaaaactgctggtcctattataatt
gcctgcagtaagggaggaaccagcatcgaagatcttgctgagaaatatccggatatgata
ataaaggtaccaattgatgtcttccaaggaatcactgatgaagatgctgccaaggtggtt
gatggtttagccttaaaggctgcagataaaaaggcagctattgaccaagtgaaaaaattg
tatgagcttttctgtgcgtgtgactgtacgttgttagagattaacccccttgcagagact
tctgatagccaattggttgctgctgatgcaaaattgaactttgatgacaatgctgcatac
cgtcagaaggagacttttgcttaccgtgatcccactcaagaagaccctcgagaggttgct
gctgcaaaagcagatttgaattatattggtttggatggagagattggttgcatggtgaat
ggtgcaggattggcaatggctactatggacattatcaagttgcatggtggaactcctgcc
aacttcttggacgttggtggaaatgcttcagagagccaggtggtggaagcatttaagata
ttgacatctgatgagaaggtcaaggccatcttggtcaatatatttggaggtatcatgaag
tgtgatgtcattgcaagtggaattgtcaatgcagccaaacaggtttccttgaaagtacca
gtggttgttcgcctggaaggcacaaatgtggaccagggaaagagaatactaaaggagagc
gggatgacattgatcacggcagaagacctagacgatgcggctgagaaggcagttaaagca
ttagctagttga

DBGET integrated database retrieval system