KEGG   Eucalyptus grandis (rose gum): 104456274Help
Entry
104456274         CDS       T03547                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:egr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    104456274
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:egr03011]
    104456274
Ribosome [BR:egr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    104456274
  Bacteria
    104456274
  Archaea
    104456274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 104456274
NCBI-ProteinID: XP_018717594
UniProt: A0A059AUW6
Position
Unknown
AA seq 273 aa AA seqDB search
MAWRTQLRTLLCRAGKRLEIDGNAAAGVSGSRLLSSSASGGAPNLQRLWESPSANVLRPL
YQYLQQSGISSSRKLLADSSDAAPISSPLTPTLQLSSGTVESQKVVSKPSKVQAVLKGIK
QSPKKVNLVAALVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANATHNHGLDPEKLLL
AEAFVGKGFYQKRISYHSKGRCGIKVRPECRLTIVVREITAEEEAEIAKLRVSNFKKLTK
RERRLVPHKLIESTPIWNRKGKAGRNEERAMAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcttggcggacgcagttacgaaccttgctgtgccgtgccgggaaaaggctggagatt
gatggcaatgcggccgccggcgtctctggttcccgtctgctgtcttcttccgcgtctggt
ggcgcccccaatttgcagagactctgggaatctccttctgcaaacgtattgaggccgcta
taccaatatcttcaacagtcggggatttctagttcaagaaagctcctggctgattcatct
gatgcagctcctatttcttctccattaacacctacgttgcaactaagcagtggaacggtt
gaaagtcagaaagtggtttctaagccttcaaaagttcaagcagtattgaaaggcataaag
cagagtcctaagaaggtcaatttggttgctgctttggttcgtggaatgcgtgttgaagat
gcactgttgcaattgcaagtgaccgtaaagagagctgcgaaaaccgtctaccaggttatt
cactctgccagagcaaatgcgacacacaaccatggattagatcctgaaaagcttcttctt
gctgaagcatttgtaggaaaggggttttaccagaagaggattagctaccattcaaaagga
aggtgtggaatcaaagtgagacctgagtgccgcctgacaatagtagtcagggagataacc
gccgaggaagaggctgagatagcaaagctgagagtaagcaatttcaaaaagcttacaaag
cgggagaggcggcttgttccccataagctcatcgagtccactccaatctggaaccgtaaa
ggcaaagctggcaggaatgaagagagggcaatggctgcatga

DBGET integrated database retrieval system